Recombinant Full Length Putative Phosphatidylcholine:Ceramide Cholinephosphotransferase 1(Sms-1) Protein, His-Tagged
Cat.No. : | RFL21713CF |
Product Overview : | Recombinant Full Length Putative phosphatidylcholine:ceramide cholinephosphotransferase 1(sms-1) Protein (Q9U3D4) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MSVTVEVADEETHDVPLVEQVRTTPDQNVDVKVQENNVVTTKIGPKLETIPAAKMQDDNG DEEKAENSEGAAAEKVEKQHDDDGVVVHEETDGVASSRSSHHDKQKPGETKKSGDGKMDD DDIITTARSSSRRICGSAASSSDSETADDAPLLPDEGPSHAVRLEMPGDKPASPHDRFPK TPLKTLVAFLMLVVAAAGNTITLSWIHERYPLTPPLPDIVFELIPKIPWGLRLCENLMIG SFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTPVPKADEDFECSPRFGENAT FSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHW LSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFW FPLLRWFEGDIRRPVPRRFDCPISYSQVCNAFRRVRPRGRNGAARPAFE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sms-1 |
Synonyms | sms-1; H21P03.3; Phosphatidylcholine:ceramide cholinephosphotransferase 1; PC:ceramide cholinephosphotransferase 1; Sphingomyelin synthase 1; CSS3alpha1; SMS-1 |
UniProt ID | Q9U3D4 |
◆ Recombinant Proteins | ||
CD40LG-0946H | Recombinant Human CD40LG Protein | +Inquiry |
TTLL9-9745M | Recombinant Mouse TTLL9 Protein, His (Fc)-Avi-tagged | +Inquiry |
TINCR-1873H | Recombinant Human TINCR Protein, His-tagged | +Inquiry |
RFL36003HF | Recombinant Full Length Human Olfactory Receptor 5H15(Or5H15) Protein, His-Tagged | +Inquiry |
SDPR-4953R | Recombinant Rat SDPR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Ferritin-181R | Native Rat Ferritin | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
F10-9H | Native Human Factor Xa, Active Site Labeled with Biotin | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEN1-1077HCL | Recombinant Human MEN1 cell lysate | +Inquiry |
CCKAR-7736HCL | Recombinant Human CCKAR 293 Cell Lysate | +Inquiry |
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
HA-2262ICL | Recombinant Influenza B HA cell lysate | +Inquiry |
NT5E-2073HCL | Recombinant Human NT5E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sms-1 Products
Required fields are marked with *
My Review for All sms-1 Products
Required fields are marked with *
0
Inquiry Basket