Recombinant Full Length Putative Permease Perm(Perm) Protein, His-Tagged
Cat.No. : | RFL6166EF |
Product Overview : | Recombinant Full Length Putative permease perM(perM) Protein (P0AFJ0) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MLEMLMQWYRRRFSDPEAIALLVILVAGFGIIFFFSGLLAPLLVAIVLAYLLEWPTVRLQ SIGCSRRWATSIVLVVFVGILLLMAFVVLPIAWQQGIYLIRDMPGMLNKLSDFAATLPRR YPALMDAGIIDAMAENMRSRMLTMGDSVVKISLASLVGLLTIAVYLVLVPLMVFFLLKDK EQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVLEMIVVGIATWLGFLLFGLNYSL LLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTEFWSCFAVYLIIQALDGNLLVPVL FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVIHAWPDGQIAQE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | perM |
Synonyms | perM; Z3755; ECs3355; Putative permease PerM |
UniProt ID | P0AFJ0 |
◆ Recombinant Proteins | ||
CD86-55HAF647 | Recombinant Human CD86 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
PPX-1965E | Recombinant Escherichia coli PPX Protein (2-513 aa), His-SUMO-tagged | +Inquiry |
MAPK6-2263C | Recombinant Chicken MAPK6 | +Inquiry |
NUDT8-1407H | Recombinant Human NUDT8, GST-tagged | +Inquiry |
TREML1-4949R | Recombinant Rhesus monkey TREML1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
α-Crystallin-01B | Native Bovine α-Crystallin Protein | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
AC-62H | Native Human Activated Protein C | +Inquiry |
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM242-7982HCL | Recombinant Human C6orf35 293 Cell Lysate | +Inquiry |
ILF2-5222HCL | Recombinant Human ILF2 293 Cell Lysate | +Inquiry |
LIMS1-4736HCL | Recombinant Human LIMS1 293 Cell Lysate | +Inquiry |
SLC43A2-1713HCL | Recombinant Human SLC43A2 293 Cell Lysate | +Inquiry |
GRAP2-5757HCL | Recombinant Human GRAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All perM Products
Required fields are marked with *
My Review for All perM Products
Required fields are marked with *
0
Inquiry Basket