Recombinant Full Length Putative Membrane Protein Mmpl6(Mmpl6) Protein, His-Tagged
Cat.No. : | RFL22058HF |
Product Overview : | Recombinant Full Length Putative membrane protein mmpL6(mmpL6) Protein (Q10773) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MQGISVTGLVKRGWMVRSVFDTIDGIDQLGEQLASVTVTLDKLAAIQPQLVALLPDEIAS QQINRELALANYATMSGIYAQTAALIENAAAMGQAFDAAKNDDSFYLPPEAFDNPDFQRG LKLFLSADGKAARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIYLAGTAAT FKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGASFGLSVLVWQ HLLGIQLYWIVLALAVILLLAVGSDYNLLLISRFKEEIGAGLNTGIIRAMAGTGGVVTAA GLVFAATMSSFVFSDLRVLGQIGTTIGLGLLFDTLVVRAFMTPSIAVLLGRWFWWPQRVR PRPASRMLRPYGPRPVVRELLLREGNDDPRTQVATHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Putative membrane protein mmpL6(mmpL6) |
UniProt ID | Q10773 |
◆ Native Proteins | ||
pepsin -173P | Native Pig pepsin | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIAS2-3204HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
ZNF460-68HCL | Recombinant Human ZNF460 293 Cell Lysate | +Inquiry |
LRRC36-4633HCL | Recombinant Human LRRC36 293 Cell Lysate | +Inquiry |
FOLH1-2452MCL | Recombinant Mouse FOLH1 cell lysate | +Inquiry |
CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Putative membrane protein mmpL6(mmpL6) Products
Required fields are marked with *
My Review for All Putative membrane protein mmpL6(mmpL6) Products
Required fields are marked with *
0
Inquiry Basket