Recombinant Full Length Putative L,D-Transpeptidase Mb0493 (Mb0493) Protein, His-Tagged
Cat.No. : | RFL24908MF |
Product Overview : | Recombinant Full Length Putative L,D-transpeptidase Mb0493 (Mb0493) Protein (P64704) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MVIRVLFRPVSLIPVNNSSTPQSQGPISRRLALTALGFGVLAPNVLVACAGKVTKLAEKR PPPAPRLTFRPADSAADVVPIAPISVEVGDGWFQRVALTNSAGKVVAGAYSRDRTIYTIT EPLGYDTTYTWSGSAVGHDGKAVPVAGKFTTVAPVKTINAGFQLADGQTVGIAAPVIIQF DSPISDKAAVERALTVTTDPPVEGGWAWLPDEAQGARVHWRPREYYPAGTTVDVDAKLYG LPFGDGAYGAQDMSLHFQIGRRQVVKAEVSSHRIQVVTDAGVIMDFPCSYGEADLARNVT RNGIHVVTEKYSDFYMSNPAAGYSHIHERWAVRISNNGEFIHANPMSAGAQGNSNVTNGC INLSTENAEQYYRSAVYGDPVEVTGSSIQLSYADGDIWDWAVDWDTWVSMSALPPPAAKP AATQIPVTAPVTPSDAPTPSGTPTTTNGPGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB0493 |
Synonyms | BQ2027_MB0493; L,D-transpeptidase Mb0493; LDT Mb0493 |
UniProt ID | P64704 |
◆ Recombinant Proteins | ||
HMGB1-3079H | Recombinant Human HMGB1 Protein (Gly2-Phe89) | +Inquiry |
IL6-474P | Recombinant Pig IL6 protein, His-tagged | +Inquiry |
Cmklr1-1039M | Recombinant Mouse Cmklr1 Full Length Transmembrane protein, His-tagged | +Inquiry |
Gnrh1-7816R | Recombinant Rat Gnrh1 protein, His & S-tagged | +Inquiry |
YWMB-3989B | Recombinant Bacillus subtilis YWMB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
Protein Z-91H | Native Human Protein Z | +Inquiry |
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUV420H1-1332HCL | Recombinant Human SUV420H1 293 Cell Lysate | +Inquiry |
AMMECR1-8880HCL | Recombinant Human AMMECR1 293 Cell Lysate | +Inquiry |
CXorf21-7158HCL | Recombinant Human CXorf21 293 Cell Lysate | +Inquiry |
Heart-811H | Hamster Heart Membrane Lysate, Total Protein | +Inquiry |
NME2-3791HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB0493 Products
Required fields are marked with *
My Review for All BQ2027_MB0493 Products
Required fields are marked with *
0
Inquiry Basket