Recombinant Full Length Putative Abc Transporter Atp-Binding Protein Exp8(Exp8) Protein, His-Tagged
Cat.No. : | RFL29070SF |
Product Overview : | Recombinant Full Length Putative ABC transporter ATP-binding protein exp8(exp8) Protein (P35598) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MQNKQEQWTVLKRLMSYLKPYGLLTFLALSFLLATTVIKSVIPLVASHFIDQYLSNLNQL AVTVLLVYYGLYILQTVVQYVGNLLFARVSYSIVRDIRRDAFANMEKLGMSYFDKTPAGS IVSRLTNDTETISDMFSGILSSFISAVFIFLTTLYTMLVLDFRLTALVLLFLPLIFLLVN LYRKKSVKIIEKTRSLLSDINSKLAENIEGIRIIQAFNQEKRLQAEFDEINQEHLVYANR SVALDALFLRPAMSLLKLLGYAVLMAYFGYRGFSIGITVGTMYAFIQYINRLFDPLIEVT QNFSTLQTAMVSAGRVFALIDERTYEPLQENGQAKVQEGNIRFEHVCFSYDGKHPILDDI SFSVNKGETIAFVGHTGSGKSSIINVLMRFYEFQSGRVLLDDVDIRDFSQEELRKNIGLV LQEPFLYHGTIKSNIAMYQETSDEQVQAAAAFVDADSFIQELPQGYDSPVSERGSSFSTG QRQLLAFARTVASQPKILILDEATANIDSETESLVQASLAKMRQGRTTIAIAHRLSTIQD ANCIYVLDKGRIIESGTHEELLALGGTYHKMYSLQAGAMADTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | exp8 |
Synonyms | exp8; SP_1839; Putative ABC transporter ATP-binding protein exp8; Exported protein 8 |
UniProt ID | P35598 |
◆ Native Proteins | ||
Egf-635R | Native Rat Egf | +Inquiry |
IgG-152R | Native Rat IgG Fab fragment | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2E1-5702HCL | Recombinant Human GTF2E1 293 Cell Lysate | +Inquiry |
WDR55-340HCL | Recombinant Human WDR55 293 Cell Lysate | +Inquiry |
EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
Ovary-771C | Chicken Ovary Membrane Lysate, Total Protein | +Inquiry |
SLC44A2-1712HCL | Recombinant Human SLC44A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All exp8 Products
Required fields are marked with *
My Review for All exp8 Products
Required fields are marked with *
0
Inquiry Basket