Recombinant Full Length Putative 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Acl-12(Acl-12) Protein, His-Tagged
Cat.No. : | RFL13722CF |
Product Overview : | Recombinant Full Length Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-12(acl-12) Protein (Q11087) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MLKSGLMDTDDQKVGVRVANIDMSERTDNVHLIEIRRIISLVGAAYFFFMTAWVVPVACV ITVSLLFPLMLFSTPLFNYLEHKLCAMVNAHWNAVSVFVGATVTEYGTNLAGYAEEKCLL LANHLGLLDHFVLMQSLNGKGSIRSRWMWVIYNIWKYTPLGVMWTSHGNFFVNGGVSKRD SVLSSFRDHLKNSFYKYDYGWVIMYPEGSRLYLVKNSGRTFAEKNGLKPLDNCVYPRTGA AHAVLDVLGPTDDSLSMSKCGKGEPIKYIIDATIGYRKGAVPDICDVMMGDWESVEASQF AVHYDVIPVKPEWSDENLLKEFLYERYIIKDKLLAEFYKTGHFPGDKTKVIPNNYEMMFA QVFWGCLYYAHYVYWLRPLIVHSWTSFLSIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | acl-12 |
Synonyms | acl-12; C01C10.3; Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-12; 1-AGP acyltransferase; 1-AGPAT; Lysophosphatidic acid acyltransferase; LPAAT |
UniProt ID | Q11087 |
◆ Native Proteins | ||
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR1-7698HCL | Recombinant Human CCR1 293 Cell Lysate | +Inquiry |
CA7-7913HCL | Recombinant Human CA7 293 Cell Lysate | +Inquiry |
C11orf85-8331HCL | Recombinant Human C11orf85 293 Cell Lysate | +Inquiry |
CDH6-2727HCL | Recombinant Human CDH6 cell lysate | +Inquiry |
KCNJ8-5043HCL | Recombinant Human KCNJ8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All acl-12 Products
Required fields are marked with *
My Review for All acl-12 Products
Required fields are marked with *
0
Inquiry Basket