Recombinant Full Length Psychrobacter Sp. Upf0761 Membrane Protein Psycprwf_0630 (Psycprwf_0630) Protein, His-Tagged
Cat.No. : | RFL26036PF |
Product Overview : | Recombinant Full Length Psychrobacter sp. UPF0761 membrane protein PsycPRwf_0630 (PsycPRwf_0630) Protein (A5WD44) (1-538aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psychrobacter sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-538) |
Form : | Lyophilized powder |
AA Sequence : | MEKLLKKLPFYDHTWFNFLRFLIGNFIKDDGQQKAASLTYTTLLSIVPILTVLLMILSSV PALESVREQISNIIYSNLLPQSGLQVSEYINNFAEKSSNLTAIGALALFVTTIMTLTTIE RAFNQIWRVEDRSGGIKSIVRYWTIITLGPLVLGTAFLVSSAVQSLSFLNQQVAGYGIDW GFWVQVVSFAVTIAGFIGMYWFIPKAKVPLKNAAIAGVFVAVTFELLKYSFGIIMSNFTS YEAIYGAFAALPIFLLWIYLSWNLILLGVEISYTLTIFATSEVYPRHPLLSLLDMLNLVH DRYQQGKDTSEEDLRSVLGRKELPKWFTYLNYLKDAHLITETDEGNYVLKKDLDNITLWE FYRTLPYPLPIKDELDEVCANARTPWLSLLVQRFVQTEKHARQELDIPLAKIFAHSLPRE KVEVSHSVFSAQDADAKRTTSQSTTAEGGRQSAAEDGKFDAQPFDPNADVLPDSDSKEAT NPPDADIKAAAAKGTVNSAQHSKHTETAKQEHKKTGLLGLFSHDKDAPIITEDDNPNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PsycPRwf_0630 |
Synonyms | PsycPRwf_0630; UPF0761 membrane protein PsycPRwf_0630 |
UniProt ID | A5WD44 |
◆ Recombinant Proteins | ||
TSC22D3-29062TH | Recombinant Human TSC22D3 | +Inquiry |
IIGP1-4483M | Recombinant Mouse IIGP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MXD3-5775H | Recombinant Human MXD3 Protein, GST-tagged | +Inquiry |
IGDCC3-4458M | Recombinant Mouse IGDCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTLA-567H | Active Recombinant Human BTLA Protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Lectin-1741M | Active Native Musa Paradisiaca (Banana) Lectin Protein | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEATR2-777HCL | Recombinant Human HEATR2 cell lysate | +Inquiry |
LCN8-4798HCL | Recombinant Human LCN8 293 Cell Lysate | +Inquiry |
GNPDA1-724HCL | Recombinant Human GNPDA1 cell lysate | +Inquiry |
NR0B1-3723HCL | Recombinant Human NR0B1 293 Cell Lysate | +Inquiry |
CLOCK-7436HCL | Recombinant Human CLOCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PsycPRwf_0630 Products
Required fields are marked with *
My Review for All PsycPRwf_0630 Products
Required fields are marked with *
0
Inquiry Basket