Recombinant Full Length Psilotum Nudum Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL12508PF |
Product Overview : | Recombinant Full Length Psilotum nudum NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q8WHX4) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psilotum nudum (Whisk fern) (Lycopodium nudum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MIIFMKDFEEQVMNLVNLLGISKDLFFILWTVLSILTLLLGVTMGVLVIVWLERKISAGM QQRMGPEYTGPLGILQTLMDGIKLLLKEDIVPAKGNTWLFNLGPAIVVIPVFLSYLVIPF GQKMILSDLGIGVFFWIAVSSIVPLGLLMTGYGSNNKYSFLGGLRAAAQSISYEIPLALC VLSISLLSNSLSTVDIVEAQSKYGILGWNLWRQPVGFIVFIVSSLAECERLPFDLPEAEE ELVAGYQTEYSSIKFGFFFIGSYLNLLVSSLFVTVLYLGGWDLSLPFLPGLNHITMTWYS SDGITEVPSIFLSFFITLIKAFLFLFVSIAARWTLPRVRMDQLLDLGWKFLLPIALGNLL LTASFQLLLLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q8WHX4 |
◆ Recombinant Proteins | ||
MYB21-1298A | Recombinant Arabidopsis thaliana MYB21 Protein (Full Length), N-GST tagged | +Inquiry |
MBD4-224H | Recombinant Human MBD4 protein, T7/His-tagged | +Inquiry |
ACE2-0078H | Recombinant Human ACE2 Protein (Leu392-Ser740), His-tagged | +Inquiry |
ABHD2-6465H | Recombinant Human ABHD2 protein, GST-tagged | +Inquiry |
PRC1A-1240Z | Recombinant Zebrafish PRC1A | +Inquiry |
◆ Native Proteins | ||
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA8 & ITGB1-1876HCL | Recombinant Human ITGA8 & ITGB1 cell lysate | +Inquiry |
GFRA1-961RCL | Recombinant Rat GFRA1 cell lysate | +Inquiry |
LRRC23-4642HCL | Recombinant Human LRRC23 293 Cell Lysate | +Inquiry |
PHF3-3227HCL | Recombinant Human PHF3 293 Cell Lysate | +Inquiry |
UBLCP1-550HCL | Recombinant Human UBLCP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket