Recombinant Full Length Pseudomonas Syringae Pv. Tomato Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL34989PF |
Product Overview : | Recombinant Full Length Pseudomonas syringae pv. tomato Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q881Q1) (1-668aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Syringae Pv. Tomato |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-668) |
Form : | Lyophilized powder |
AA Sequence : | MNQKVDIEALHETSINSDQPLLRLQQVSRSFMAGDREFQVLKHIDLAIHTGELVAIIGAS GSGKSTLMNILGCLDHASAGSYQVNGQETRELDDDALAALRRDHFGFIFQRYHLLPHLDA VRNVEIPAIYAGTAQTTRHERAQALLTRLGLGGHLQHRPSQMSGGQQQRVSIARALMNGG QVILADEPTGALDTASGKEVMRTLLELHAAGHTVILVTHDPKVAANAERIIEVSDGEIIS DRRTAQTTQPAPEAQPATPPGPAPRRLLASLGLFREAFNMAWIALISHRMRTLLTMLGII IGITSVVSISAIGEGAKRYVLKDIQSIGSNTIDIYAGANFGDSRAKSIETLLPSDVAALN QLYYIDSATPVVGRSMLVRYRNVDVDAQLNGVSSRYFQVRNIQLAAGITFSDQDARRQAQ VVVLDHNTAQRLFGPGVNPLGQVILVGKLPCTVIGVTSDHKNLFIAGNTLNLWMPYETAA GRVLGQRHLDSISVRVKDGMPSKAVEEQIKALMLQRHGTKDFFTNNLDSVMQTVQKTSRS LTLLLSLIAVISLVVGGIGVMNIMLVSVTERTREIGIRMAVGARQSDIRQQFLVEAVMVC LMGGVIGIGLSYAIGYLFTLFVQQWEMVFSLASVVTAFACSTLIGVLFGFVPARNAARLD PIEALARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; PSPTO_2832; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q881Q1 |
◆ Recombinant Proteins | ||
BCAN-300H | Active Recombinant Human BCAN, His-tagged | +Inquiry |
Pdgfa-4754M | Active Recombinant Mouse Pdgfa Protein | +Inquiry |
ETFBKMT-2300H | Recombinant Human ETFBKMT Protein, MYC/DDK-tagged | +Inquiry |
RFL31203MF | Recombinant Full Length Mouse Platelet Glycoprotein V(Gp5) Protein, His-Tagged | +Inquiry |
RFL6887BF | Recombinant Full Length Brucella Abortus Type Iv Secretion System Protein Virb2(Virb2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
BOD-38 | Active Native Bilirubin oxidase | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHC3-1343HCL | Recombinant Human PHC3 cell lysate | +Inquiry |
HEXA-548HCL | Recombinant Human HEXA cell lysate | +Inquiry |
Fetal Thyroid-175H | Human Fetal Thyroid Lysate | +Inquiry |
NT5E-2491MCL | Recombinant Mouse NT5E cell lysate | +Inquiry |
RERG-2418HCL | Recombinant Human RERG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket