Recombinant Full Length Pseudomonas Putida Xylene Monooxygenase Subunit 1(Xylm) Protein, His-Tagged
Cat.No. : | RFL7089PF |
Product Overview : | Recombinant Full Length Pseudomonas putida Xylene monooxygenase subunit 1(xylM) Protein (P21395) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Putida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-369) |
Form : | Lyophilized powder |
AA Sequence : | MDTLRYYLIPVVTACGLIGFYYGGYWVWLGAATFPALMVLDVILPKDFSARKVSPFFADL TQYLQLPLMIGLYGLLVFGVENGRIELSEPLQVAGCILSLAWLSGVPTLPVSHELMHRRH WLPRKMAQLLAMFYGDPNRDIAHVNTHHLYLDTPLDSDTPYRGQTIYSFVISATVGSVKD AIKIEAETLRRKGQSPWNLSNKTYQYVALLLALPGLVSYLGGPALGLVTIASMIIAKGIV EGFNYFQHYGLVRDLDQPILLHHAWNHMGTIVRPLGCEITNHINHHIDGYTRFYELRPEK EAPQMPSLFVCFLLGLIPPLWFALIAKPKLRDWDQRYATPGERELAMAANKKAGWPLWCE SELGRVASI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | xylM |
Synonyms | xylM; Xylene monooxygenase subunit 1 |
UniProt ID | P21395 |
◆ Native Proteins | ||
MB-30275TH | Native Human MB | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
PPBP-30279TH | Native Human PPBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOL1-001HCL | Recombinant Human APOL1 cell lysate | +Inquiry |
IL17RA-2640HCL | Recombinant Human IL17RA cell lysate | +Inquiry |
PARK2-3433HCL | Recombinant Human PARK2 293 Cell Lysate | +Inquiry |
GTF3C2-5690HCL | Recombinant Human GTF3C2 293 Cell Lysate | +Inquiry |
UPP1-494HCL | Recombinant Human UPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All xylM Products
Required fields are marked with *
My Review for All xylM Products
Required fields are marked with *
0
Inquiry Basket