Recombinant Full Length Pseudomonas Putida Probable Intracellular Septation Protein A (Pputgb1_4007) Protein, His-Tagged
Cat.No. : | RFL23031PF |
Product Overview : | Recombinant Full Length Pseudomonas putida Probable intracellular septation protein A (PputGB1_4007) Protein (B0KRX4) (1-197aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Putida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-197) |
Form : | Lyophilized powder |
AA Sequence : | MKQFIDFIPLLLFFIVYKLDPRPMEVAGHSFEFGGIYSATAMLIISSLVVYGALFLRQRK LKKGQWLTLIACLVFGGLTLTFHSETFLKWKAPVVNWLFALGFAGSHFIGDRVLIKRIMG HALTLPDAIWSRLNLAWIAFFLFCGAANLFVAFTFQDFWVDFKVFGSLGMTVIFLVAQGV YLSRHLHDDPSTSKPKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PputGB1_4007 |
Synonyms | yciB; PputGB1_4007; Inner membrane-spanning protein YciB |
UniProt ID | B0KRX4 |
◆ Native Proteins | ||
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
Collagen-326H | Native Human Collagen Type III | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRX1-3796HCL | Recombinant Human NLRX1 293 Cell Lysate | +Inquiry |
CASP5-7835HCL | Recombinant Human CASP5 293 Cell Lysate | +Inquiry |
P2RX1-464HCL | Recombinant Human P2RX1 lysate | +Inquiry |
UNC5B-767RCL | Recombinant Rat UNC5B cell lysate | +Inquiry |
ORC4L-3551HCL | Recombinant Human ORC4L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PputGB1_4007 Products
Required fields are marked with *
My Review for All PputGB1_4007 Products
Required fields are marked with *
0
Inquiry Basket