Recombinant Full Length Pseudomonas Putida Biopolymer Transport Protein Exbb(Exbb) Protein, His-Tagged
Cat.No. : | RFL20083PF |
Product Overview : | Recombinant Full Length Pseudomonas putida Biopolymer transport protein exbB(exbB) Protein (Q05605) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Putida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MTRTQPSASPTPSRAWRAIAALMFSLVLAPVAMADEPTANASTPAAAAAPATPAAAPAPA ADGSAPVADAPAAAPVDAPVAVDPGVEALVEDTTLGMAHDLSPWGMYKNADIVVKIVMIG LAIASIITWTIWIAKGFELMGAKRRLRGEIAQLKKSASLKEASEVSNKEGTLAHTLVHDA LEEMRLSANTREKEGIKERVAFRLERLVAASGRNMSSGTGVLATIGSTAPFVGLFGTVWG IMNSFIGIAKTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSD ASAQVLLLVSRDLDHQGSERAAPHMVKVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | exbB |
Synonyms | exbB; Biopolymer transport protein ExbB |
UniProt ID | Q05605 |
◆ Recombinant Proteins | ||
THY1-5718R | Recombinant Rat THY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM19A4-250C | Recombinant Cynomolgus Monkey FAM19A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCRG1-1647H | Recombinant Human SCRG1 Protein (21-98 aa), His-tagged | +Inquiry |
RFL10229MF | Recombinant Full Length Mycobacterium Bovis Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
DPP3-1601R | Recombinant Rat DPP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgY-006D | Native Duck IgY | +Inquiry |
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP8-7830HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
CETP-7559HCL | Recombinant Human CETP 293 Cell Lysate | +Inquiry |
AURKA-8564HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
NTRK1-2147HCL | Recombinant Human NTRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All exbB Products
Required fields are marked with *
My Review for All exbB Products
Required fields are marked with *
0
Inquiry Basket