Recombinant Full Length Pseudomonas Phage Pf3 Putative Assembly Protein Orf430 Protein, His-Tagged
Cat.No. : | RFL25767PF |
Product Overview : | Recombinant Full Length Pseudomonas phage Pf3 Putative assembly protein ORF430 Protein (P03668) (21-430aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas phage Pf3 (Bacteriophage Pf3) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-430) |
Form : | Lyophilized powder |
AA Sequence : | SDRLTVKHHEIDIRVAIPLVADFCGRSVVLGPSIQGVVSLDFDDVPCSQAFDLLLESNHL LSSMVGDVLVITAMDQVLNSERKADDLRTFRRDLFNANDIERRVINIVHASASEVVSLFK ESFMSLDAPGMSMTVDERTNSVFAALPSSFFPALESVIQAIDVPVRQVAIEANVVEASVD WSKRLGLNWGGALSLGNWSAVTAGDLSVAAGSSIGFGFLSNTLSLDGLFTAMENEGNGRV VSRPTLLTLDRQSASVLRGTELPYQQSAGDGATSVAFKHAALSLEVKPVISPDNSIVIEV LVSRDSPNFSNAIDGVPPIDTNRLVTTIRVPHGQTVVLGGVYSTINQQGSSRVSGISRIP GIGRLFKKKEHVTEQYELLIFLTPRILGLEVEPEKQSLVFDESFFLGDLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pseudomonas phage Pf3 Putative assembly protein ORF430 |
Synonyms | Putative assembly protein ORF430; ORF430 |
UniProt ID | P03668 |
◆ Recombinant Proteins | ||
HRH4-5038H | Recombinant Human HRH4 Protein, GST-tagged | +Inquiry |
CLEC12A-1456H | Recombinant Human CLEC12A Protein, GST-tagged | +Inquiry |
DCN-1929H | Recombinant Human DCN Protein (Asp31-Lys359), His tagged | +Inquiry |
FGFR1-138HF | Recombinant Human FGFR1 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
RELL2-2252H | Recombinant Human RELL2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
Lectin-1801L | Active Native Lycopersicon Esculentum Lectin Protein, Biotinylated | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACH2-8530HCL | Recombinant Human BACH2 293 Cell Lysate | +Inquiry |
PPP4C-494HCL | Recombinant Human PPP4C lysate | +Inquiry |
DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry |
OSBPL9-3530HCL | Recombinant Human OSBPL9 293 Cell Lysate | +Inquiry |
RPS20-561HCL | Recombinant Human RPS20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pseudomonas phage Pf3 Putative assembly protein ORF430 Products
Required fields are marked with *
My Review for All Pseudomonas phage Pf3 Putative assembly protein ORF430 Products
Required fields are marked with *
0
Inquiry Basket