Recombinant Full Length Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL13824VF |
Product Overview : | Recombinant Full Length Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (Q8DDQ1) (1-544aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Vulnificus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-544) |
Form : | Lyophilized powder |
AA Sequence : | MTPTELKRLYRIIKVQLEYGLDDLLPDHQLAKAPRWMRKSLFWLKNQHPEKPLGDRLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADPLALLQDQVSPFDGALAKAQMEQALGGPLETW FSDFDLVPLASASIAQVHTAKLKTTNQEVVLKVIRPDIRPIIDADLKLMRRMARIVAKAM PEARRLKPIEVVREYEKTLLDELDLRREAANAIQLRRNFTDSEELYVPEVYPDFSNETVM VSERIYGIQVSDIAGLKANGTNMKLLAERGVSVFFTQVFRDSFFHADMHPGNVFVNPEHP ENPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAELHVDSGWVPADTNIDEFEF AIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWETAKPFLEEWMMNQVGPKALINAIKDRAPYWAEKLPELPELLYDSLKQGKAMNQR MDQLYQGYRASKRQQATGKFLFGVGATLVVCSAILVDHTYEQLSLATAIAGVTFWLFSWR AYRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; aarF; VV1_0907; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | Q8DDQ1 |
◆ Recombinant Proteins | ||
ATP1A1-2113M | Recombinant Mouse ATP1A1 Protein | +Inquiry |
SE0890-2846S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0890 protein, His-tagged | +Inquiry |
Tec-8070M | Recombinant Mouse Tec protein, His & T7-tagged | +Inquiry |
DCLRE1A-11855H | Recombinant Human DCLRE1A, GST-tagged | +Inquiry |
ULBP1-096HB | Active Recombinant Human ULBP1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
F9-300R | Native Rat Factor IX | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
D2HGDH-7088HCL | Recombinant Human D2HGDH 293 Cell Lysate | +Inquiry |
PPP2R5D-2915HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
ACTB-20HCL | Recombinant Human ACTB cell lysate | +Inquiry |
SETDB1-1923HCL | Recombinant Human SETDB1 293 Cell Lysate | +Inquiry |
TUFT1-640HCL | Recombinant Human TUFT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket