Recombinant Full Length Pseudomonas Aeruginosa Upf0761 Membrane Protein Pspa7_4558 (Pspa7_4558) Protein, His-Tagged
Cat.No. : | RFL33891PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa UPF0761 membrane protein PSPA7_4558 (PSPA7_4558) Protein (A6VA22) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MREHFNDGIEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG ESIQTFIFRNFVPSAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIW RVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDALPGAETLLGLMPL AFSVAAFTLLYSAVPNARVPVRHALMGGMFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFA TVPIFLLWIYLSWMIVLFGAVLVCNLSSSRLWRRRSLPKPIVLLGVLRVFHQRQQLGQSM RLVHLHRAGWLLPEDEWEELLDFLEKEQFVCRVGGGEWVLCRDLGSYSLHRLLNRCPWPM PSRERMPAQLDEAWYPAFQQAMERLQAEQERLFGESLAHWLAEGNASAKVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PSPA7_4558 |
Synonyms | PSPA7_4558; UPF0761 membrane protein PSPA7_4558 |
UniProt ID | A6VA22 |
◆ Recombinant Proteins | ||
PDCD5-623H | Recombinant Human PDCD5 Protein, His-tagged | +Inquiry |
WNT3A-265H | Recombinant Human WNT3A, StrepII-tagged | +Inquiry |
MCAT-9622M | Recombinant Mouse MCAT Protein | +Inquiry |
RFL29473MF | Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0979(Mj0979) Protein, His-Tagged | +Inquiry |
HSP90B1-351C | Recombinant Cynomolgus Monkey HSP90B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
C3c-11H | Native Human C3c Protein | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-311H | Human Lung Lupus Lysate | +Inquiry |
SELE-845MCL | Recombinant Mouse SELE cell lysate | +Inquiry |
ALS2CL-67HCL | Recombinant Human ALS2CL cell lysate | +Inquiry |
FAM45A-6377HCL | Recombinant Human FAM45A 293 Cell Lysate | +Inquiry |
MICB-2712HCL | Recombinant Human MICB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PSPA7_4558 Products
Required fields are marked with *
My Review for All PSPA7_4558 Products
Required fields are marked with *
0
Inquiry Basket