Recombinant Full Length Pseudomonas Aeruginosa Protein Pilj(Pilj) Protein, His-Tagged
Cat.No. : | RFL28211PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Protein pilJ(pilJ) Protein (P42257) (1-682aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-682) |
Form : | Lyophilized powder |
AA Sequence : | MKKINAGNLFAGMRSSSVIAGLFIVLIVSIVLLFANFAYLNTQSNHDKQYIGHAGELRVL SQRIAKNATEAAAGKGEAFKLLKDARNDFEKRWNILVNGDESTSLPPSPEAVKPQMDVVQ QDWDGLRKNADSILASEQTVLSLHQVASTLAETIPQLQVEYEEVVDILLENGAPADQVAV AQRQSLLAERILGSVNKVLAGDENSVQAADSFGRDASLFGRVLKGMQEGNAAMSISKVTN AEAVDRLNEIAELFEFVSGSVDEILETSPDLFQVREAANNIFSVSQTLLDKASQLADGFE NLAGGRSINLFAGYALGALALASIILIGLVMVRETNRRLAETAEKNDRNQAAILRLLDEI ADLADGDLTVAATVTEDFTGAIADSINYSIDQLRELVETINQTAVQVAAAAQETQSTAMH LAEASEHQAQEIAGASAAINEMAVSIDQVSANASESSAVAERSVAIANKGNEVVHNTITG MDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIADQTNILALNAAIQASMAGDAGRGF AVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAVISMEQTTSEVVRGARLAQDAGVAL EEIEKVSKTLAALIQNISNAARQQASSAGHISNTMNVIQEITSQTSAGTTATARSIGNLA KMASEMRNSVSGFKLPEGVEQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pilJ |
Synonyms | pilJ; PA0411; Protein PilJ |
UniProt ID | P42257 |
◆ Recombinant Proteins | ||
MCM2-9634M | Recombinant Mouse MCM2 Protein | +Inquiry |
YUFO-2003B | Recombinant Bacillus subtilis YUFO protein, His-tagged | +Inquiry |
TMEM173-284H | Recombinant Human TMEM173 Protein, MYC/DDK-tagged | +Inquiry |
SAP30BP-3890R | Recombinant Rhesus Macaque SAP30BP Protein, His (Fc)-Avi-tagged | +Inquiry |
NKAIN3-10685M | Recombinant Mouse NKAIN3 Protein | +Inquiry |
◆ Native Proteins | ||
VTN-5410H | Native Human Vitronectin | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
C3orf37-8046HCL | Recombinant Human C3orf37 293 Cell Lysate | +Inquiry |
ZNF560-51HCL | Recombinant Human ZNF560 293 Cell Lysate | +Inquiry |
DMAP1-6901HCL | Recombinant Human DMAP1 293 Cell Lysate | +Inquiry |
ANKRD54-8846HCL | Recombinant Human ANKRD54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pilJ Products
Required fields are marked with *
My Review for All pilJ Products
Required fields are marked with *
0
Inquiry Basket