Recombinant Full Length Pseudomonas Aeruginosa Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL20903PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q9I190) (1-663aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-663) |
Form : | Lyophilized powder |
AA Sequence : | MENATQPVPLIELRDIRKRYGGNGTPEVEVLKGVSLSIHAGEFVAIVGASGSGKSTLMNI LGCLDRPSSGSYHFAGHDVAELDSDEQAWLRREAFGFVFQGYHLIPSASAQENVEMPAIY AGIPASERHTRARALLERLGLAERTANRPHQLSGGQQQRVSIARALMNGGHIILADEPTG ALDSHSGAEVMALLDELASQGHVVILITHDRDVAARAKRIIEVRDGEIVSDSANDERPAH PSAGVERHLQADDLSQRLAEGSSEPSGAWRAELLEAVRAAWRVMWINRFRTALTLLGIII GVASVVVMLAVGEGSKRQVMAQMGAFGSNIIYLSGYSPNPRAPMGIVSSDDVAAIATLPQ VKKVMPVNGGELVVRYGNIDYHAYVGGNNTDFPEILNWPVAEGSYFTERDEDAATTVAVI GYKVRKKLFGSANPIGRYILIENVPFQVIGVLAEKGSSSGDKDADNRIAIPYSAASIRLF GTRNPEYVIIAAADAQRVHQAERAIDQLMLRLHRGQRDYELTNNAAMIQAEAKTQNTLSL MLGSIAAISLLVGGIGVMNIMLMTVRERTREIGIRMATGARQGDILRQFLTEAAMLSVVG GLAGIALALCIGGVLLLGQVAVAFSLSAIVGAFSCALVTGLVFGFMPARKAAQLDPVAAL ASQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; PA2390; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q9I190 |
◆ Recombinant Proteins | ||
OR4D5-3200R | Recombinant Rhesus monkey OR4D5 Protein, His-tagged | +Inquiry |
GAL3ST1A-6752Z | Recombinant Zebrafish GAL3ST1A | +Inquiry |
Pecr-495M | Recombinant Mouse Pecr Protein, MYC/DDK-tagged | +Inquiry |
Il9-01M | Active Recombinant Mouse Il9 Protein, His-Tagged | +Inquiry |
GABPB2-13091H | Recombinant Human GABPB2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
COL5-136H | Native Human Collagen Type IV | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
FGA-78H | Active Native Human Fibrinogen (Pg & vWF depleted) | +Inquiry |
ALB-8301S | Native Sheep ALB | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD10-14HCL | Recombinant Human ACAD10 cell lysate | +Inquiry |
EL4-4H | Human EL4 lysate | +Inquiry |
C19orf10-218HCL | Recombinant Human C19orf10 cell lysate | +Inquiry |
MAMDC2-400HCL | Recombinant Human MAMDC2 lysate | +Inquiry |
SERTAD2-1934HCL | Recombinant Human SERTAD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket