Recombinant Full Length Pseudomonas Aeruginosa Cytochrome O Ubiquinol Oxidase Subunit 3(Cyoc) Protein, His-Tagged
Cat.No. : | RFL35728PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Cytochrome o ubiquinol oxidase subunit 3(cyoC) Protein (Q9I425) (1-209aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-209) |
Form : | Lyophilized powder |
AA Sequence : | MSTAVLNKHLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTA GGPSGKDIFELPYVLVETAILLVSSCTYGLAMLSAHKGAKGQAIAWLGVTFLLGAAFIGM EINEFHHLIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNT RMMCLSLFWHFLDIVWICVFTVVYLMGAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cyoC |
Synonyms | cyoC; PA1319; Cytochrome bo(3 ubiquinol oxidase subunit 3; Cytochrome o ubiquinol oxidase subunit 3; Cytochrome o subunit 3; Oxidase bo(3 subunit 3; Ubiquinol oxidase polypeptide III; Ubiquinol oxidase subunit 3 |
UniProt ID | Q9I425 |
◆ Native Proteins | ||
Ubiquitin-001 | Biotinylated Ubiquitin | +Inquiry |
F9-26523H | Active Native Human F9 Protein | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
Collagen Type I-02M | Native Mouse Collagen Type I (Atelocollagen) Protein | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGLL1-5258HCL | Recombinant Human IGLL1 293 Cell Lysate | +Inquiry |
CPB1-2423MCL | Recombinant Mouse CPB1 cell lysate | +Inquiry |
C5orf34-8013HCL | Recombinant Human C5orf34 293 Cell Lysate | +Inquiry |
CASP4-7837HCL | Recombinant Human CASP4 293 Cell Lysate | +Inquiry |
PPP1CA-2952HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cyoC Products
Required fields are marked with *
My Review for All cyoC Products
Required fields are marked with *
0
Inquiry Basket