Recombinant Full Length Protein St7 Homolog (Cbg06227) Protein, His-Tagged
Cat.No. : | RFL21991CF |
Product Overview : | Recombinant Full Length Protein ST7 homolog (CBG06227) Protein (A8X0L4) (1-536aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-536) |
Form : | Lyophilized powder |
AA Sequence : | MACSWTFLWLLWIAMVAVLLFFLRGPLKISESLESVSATSYFNNLTPKFYVALTGTSSLV SGIILIFEWWYFKNNAGVEQGEDEGSDNEESIDNPKTVPECKVWRNPMALFRAAEYNRFR KETNSEPLTYYDMNLSAQDHQSLFMCDEDQGRAEYEIMQVAWRERESEQRIQTARTALAI NSECASALVLLAEEDTETVAQAENVLRRALRAIENTLSTYSNNQIASYGQNGDTVRKRDL TIQTYIKRRLAMCARKQGRLREAIKGFRDLSREQSLSTLLSVQDNLIEACLEVQAYADVQ NLLVRYDGYGTSCSYDQREPRSAAMSYTSALLKVRAVAENFRCPSESSVRRGLSSAEQTA IEALTRAMEFNPHVPPYLLEIRAMIMPPEHFLKRGDSEALAYAFFHIQHWKRIDGALQLL SIVWKDFVPKVNKDTHAFSSQLESADKELLPAWHEQSAFPQTESTLGMLIQTFACLAICI LAVLSQQVPSSYGEMLRQIVTSGVQMYENSMNTFSQWAPNNIIPYLASKPVSVPEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBG06227 |
Synonyms | CBG06227; Protein ST7 homolog |
UniProt ID | A8X0L4 |
◆ Recombinant Proteins | ||
GPR108-5166H | Recombinant Human GPR108 Protein | +Inquiry |
RTN4RL2-4857R | Recombinant Rat RTN4RL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UREB-1160B | Recombinant Bacillus subtilis UREB protein, His-tagged | +Inquiry |
RNASE12-4756H | Recombinant Human RNASE12 Protein (Glu21-Lys147), His tagged | +Inquiry |
SLC14A1-1924H | Recombinant Human SLC14A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Alb-503R | Native Rat Alb Protein | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
calc1-8308S | Native Salmon calc1 | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK11-1551MCL | Recombinant Mouse KLK11 cell lysate | +Inquiry |
PRM2-2841HCL | Recombinant Human PRM2 293 Cell Lysate | +Inquiry |
LECT1-4780HCL | Recombinant Human LECT1 293 Cell Lysate | +Inquiry |
Parathyroid-372C | Cynomolgus monkey Parathyroid Lysate | +Inquiry |
AP1M2-86HCL | Recombinant Human AP1M2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CBG06227 Products
Required fields are marked with *
My Review for All CBG06227 Products
Required fields are marked with *
0
Inquiry Basket