Recombinant Full Length Protein Cab-1(Cab-1) Protein, His-Tagged
Cat.No. : | RFL21629CF |
Product Overview : | Recombinant Full Length Protein cab-1(cab-1) Protein (Q93249) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MRYTFSDEKKATTTTTSRAKSQARLLNSASYRRAARTTLRHSYGMGMWRAVALLACLSAT HAALFTEGGAVQNGKDNKANKYVEFAHDDKINKEDLLKYYGKEVEQYKDDDSYMEYLIEY MKSHPVPAQFPNFEQEAEQEHQDELNQWLEQLMNEQELLEPANAAVKDAEQKAPLAPVHH KQVAQKPAQEPFDLDDLLRGELMLENEIAKESELKKTQEKLSEQTPSAKANVESLESAMQ TATGEPQVPQKKGQNEFVSFVEQEPQPAKQTISSQTVDKRRLATSAEYSGSAPRYSSSSL LLLAVGTVMCVGLIGTVAGGTYYYKNNRRTETPDDGEYAPYAGTGPGFRKNKGNKGDETL AYKAQLHQYQQAKQKIICGEDAPGIIESDGEDGADEENNYSVYECPGLAPTGDIEVCNPN FAAQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cab-1 |
Synonyms | cab-1; C23H4.1; Protein cab-1 |
UniProt ID | Q93249 |
◆ Recombinant Proteins | ||
LAMP2-1277H | Recombinant Human LAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FDPS-2309R | Recombinant Rat FDPS Protein | +Inquiry |
ATAD5-2060M | Recombinant Mouse ATAD5 Protein | +Inquiry |
EPX-2834M | Recombinant Mouse EPX Protein, His (Fc)-Avi-tagged | +Inquiry |
Tspyl4-6695M | Recombinant Mouse Tspyl4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
NEFM-1520B | Native Bovine NEFM | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPD6B-397HCL | Recombinant Human LYPD6B lysate | +Inquiry |
RG9MTD3-2391HCL | Recombinant Human RG9MTD3 293 Cell Lysate | +Inquiry |
EXOSC2-6503HCL | Recombinant Human EXOSC2 293 Cell Lysate | +Inquiry |
PABPC4-1271HCL | Recombinant Human PABPC4 cell lysate | +Inquiry |
ZSCAN16-9187HCL | Recombinant Human ZSCAN16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cab-1 Products
Required fields are marked with *
My Review for All cab-1 Products
Required fields are marked with *
0
Inquiry Basket