Recombinant Full Length Protein Adra(Adra) Protein, His-Tagged
Cat.No. : | RFL7321EF |
Product Overview : | Recombinant Full Length Protein AdrA(adrA) Protein (P0AAP2) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPRAVGLAGMFLPIASTL VSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKTDAVLAGMWVGVMGVNV LPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGITVSFNSAPLEWWLSLPI IVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRRHWETMLRNEFDNCRRHNR DATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGT PAESAITAMLRVHEGLNTLRLPNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAK KAGRNRTEVAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcC |
Synonyms | dgcC; adrA; c0492; Probable diguanylate cyclase DgcC; DGC |
UniProt ID | P0AAP2 |
◆ Recombinant Proteins | ||
GNAZ-1895R | Recombinant Rhesus monkey GNAZ Protein, His-tagged | +Inquiry |
DCAF7-3543C | Recombinant Chicken DCAF7 | +Inquiry |
GIMAP6-5259HF | Recombinant Full Length Human GIMAP6 Protein, GST-tagged | +Inquiry |
AYP1020-RS06945-4896S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS06945 protein, His-tagged | +Inquiry |
CD276-4893H | Recombinant Human CD276 protein, His-tagged, biotinylated | +Inquiry |
◆ Native Proteins | ||
TTR-254H | Native Human Prealbumin | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
CKM-26522TH | Native Human CKM | +Inquiry |
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF6-5161HCL | Recombinant Human IRF6 293 Cell Lysate | +Inquiry |
SLC1A3-1619HCL | Recombinant Human SLC1A3 cell lysate | +Inquiry |
Hippocampus-458C | Cat Hippocampus Lysate, Total Protein | +Inquiry |
PRR14-2815HCL | Recombinant Human PRR14 293 Cell Lysate | +Inquiry |
HIST1H2BM-5535HCL | Recombinant Human HIST1H2BM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgcC Products
Required fields are marked with *
My Review for All dgcC Products
Required fields are marked with *
0
Inquiry Basket