Recombinant Full Length Prochlorococcus Marinus Proton Extrusion Protein Pcxa(Pcxa) Protein, His-Tagged
Cat.No. : | RFL5180PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Proton extrusion protein PcxA(pcxA) Protein (A2C9Q5) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MRTFGEARSIDINNDLERGYEAALLIQTLELEYYGDRPIRPNLQLSVPRSLQSTILRKFH TAVNICRLTFEAIKPNISQLDSQEYRKFQLIETIVNRYAPKRSSRSTSMSRAPDPLPRSL LGLVDKVRRQLDPTSEATLVAGFRRRRDSTLISLKIILLLILVPLLVQQMSRTYLITPAI DYLAPDLPFLSYPKPQLEEQAVEKLRVFKAEIEFDALLKGDSIPSQDELQKALVIKANQL KDEADKESTHAVKNVLADIAALIAFAFVCIINREELRVLRGFLDEAVYGLSDSAKAFAII LFTDMFVGFHSPEGWQVLLQGIANHFGFPARENFILLFIATFPVILATIFKYWIFRYLNR VSPSSVATLRGMNGSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcxA |
Synonyms | pcxA; P9303_14691; Proton extrusion protein PcxA |
UniProt ID | A2C9Q5 |
◆ Native Proteins | ||
ALPI-8348B | Native Bovine ALPI | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
Clostripain-02C | Native Clostridium histolyticum Clostripain, Sequencing Grade | +Inquiry |
Protein C-89H | Native Human Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD8-9116HCL | Recombinant Human ACAD8 293 Cell Lysate | +Inquiry |
NUSAP1-1236HCL | Recombinant Human NUSAP1 cell lysate | +Inquiry |
CTSG-7193HCL | Recombinant Human CTSG 293 Cell Lysate | +Inquiry |
PGBD3-3259HCL | Recombinant Human PGBD3 293 Cell Lysate | +Inquiry |
POC1A-3063HCL | Recombinant Human POC1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcxA Products
Required fields are marked with *
My Review for All pcxA Products
Required fields are marked with *
0
Inquiry Basket