Recombinant Full Length Probable Sensor Histidine Kinase Nars(Nars) Protein, His-Tagged
Cat.No. : | RFL11231MF |
Product Overview : | Recombinant Full Length Probable sensor histidine kinase NarS(narS) Protein (O53857) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Tuberculosis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MPSYGNLGRLGGRHEYGVLVAMTSSAELDRVRWAHQLRSYRIASVLRIGVVGLMVAAMVV GTSRSEWPQQIVLIGVYAVAALWALLLAYSASRRFFALRRFRSMGRLEPFAFTAVDVLIL TGFQLLSTDGIYPLLIMILLPVLVGLDVSTRRAAVVLACTLVGFAVAVLGDPVMLRAIGW PETIFRFALYAFLCATALMVVRIEERHTRSVAGLSALRAELLAQTMTASEVLQRRIAEAI HDGPLQDVLAARQELIELDAVTPGDERVGRALAGLQSASERLRQATFELHPAVLEQVGLG PAVKQLAASTAQRSGIKISTDIDYPIRSGIDPIVFGVVRELLSNVVRHSGATTASVRLGI TDEKCVLDVADDGVGVTGDTMARRLGEGHIGLASHRARVDAAGGVLVFLATPRGTHVCVE LPLKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | narS |
Synonyms | narS; Rv0845; Sensor histidine kinase NarS |
UniProt ID | O53857 |
◆ Recombinant Proteins | ||
NARS-5687H | Recombinant Human NARS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Nars-4294M | Recombinant Mouse Nars Protein, Myc/DDK-tagged | +Inquiry |
NARS-3051C | Recombinant Chicken NARS | +Inquiry |
RFL11231MF | Recombinant Full Length Probable Sensor Histidine Kinase Nars(Nars) Protein, His-Tagged | +Inquiry |
NARS-4660H | Recombinant Human NARS Protein (Met1-Arg330), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NARS-1167HCL | Recombinant Human NARS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All narS Products
Required fields are marked with *
My Review for All narS Products
Required fields are marked with *
0
Inquiry Basket