Recombinant Full Length Probable Long-Chain-Fatty-Acid--Coa Ligase Fadd23(Fadd23) Protein, His-Tagged
Cat.No. : | RFL10604MF |
Product Overview : | Recombinant Full Length Probable long-chain-fatty-acid--CoA ligase FadD23(fadD23) Protein (Q7TVK7) (1-584aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-584) |
Form : | Lyophilized powder |
AA Sequence : | MVSLSIPSMLRQCVNLHPDGTAFTYIDYERDSEGISESLTWSQVYRRTLNVAAEVRRHAA IGDRAVILAPQGLDYIVAFLGALQAGLIAVPLSAPLGGASDERVDAVVRDAKPNVVLTTS AIMGDVVPRVTPPPGIASPPTVAVDQLDLDSPIRSNIVDDSLQTTAYLQYTSGSTRTPAG VMITYKNILANFQQMISAYFADTGAVPPLDLFIMSWLPFYHDMGLVLGVCAPIIVGCGAV LTSPVAFLQRPARWLQLMAREGQAFSAAPNFAFELTAAKAIDDDLAGLDLGRIKTILCGS ERVHPATLKRFVDRFSRFNLREFAIRPAYGLAEATVYVATSQAGQPPEIRYFEPHELSAG QAKPCATGAGTALVSYPLPQSPIVRIVDPNTNTECPPGTIGEIWVHGDNVAGGYWEKPDE TERTFGGALVAPSAGTPVGPWLRTGDSGFVSEDKFFIIGRIKDLLIVYGRNHSPDDIEAT IQEITRGRCAAIAVPSNGVEKLVAIVELNNRGNLDTERLSFVTREVTSAISTSHGLSVSD LVLVAPGSIPITTSGKVRRAECVKLYRHNEFTRLDAKPLQASDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fadD23 |
Synonyms | fadD23; BQ2027_MB3856; Long-chain-fatty-acid--AMP ligase FadD23; Long-chain fatty acid adenylyltransferase FadD23; Long-chain-fatty-acid adenylase/transferase FadD23 |
UniProt ID | Q7TVK7 |
◆ Recombinant Proteins | ||
TNF-51H | Recombinant Human TNF Protein | +Inquiry |
CD274-2146HAF555 | Recombinant Human CD274 Protein, mouse IgG1 mFc-tagged, low endotoxin (HPLC-verified), Alexa Fluor 555 conjugated | +Inquiry |
DDX58-7087H | Recombinant Human DDX58 protein, His-tagged | +Inquiry |
TRDMT1-2201C | Recombinant Chicken TRDMT1 | +Inquiry |
AYP1020-RS00380-6120S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS00380 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
SPARC-30653TH | Native Human SPARC | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA2-2138MCL | Recombinant Mouse EPHA2 cell lysate | +Inquiry |
PEX12-3293HCL | Recombinant Human PEX12 293 Cell Lysate | +Inquiry |
SELL-1131CCL | Recombinant Cynomolgus SELL cell lysate | +Inquiry |
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
MSRB2-4108HCL | Recombinant Human MSRB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fadD23 Products
Required fields are marked with *
My Review for All fadD23 Products
Required fields are marked with *
0
Inquiry Basket