Recombinant Full Length Probable G-Protein Coupled Receptor K01A12.3(K01A12.3) Protein, His-Tagged
Cat.No. : | RFL35100CF |
Product Overview : | Recombinant Full Length Probable G-protein coupled receptor K01A12.3(K01A12.3) Protein (Q10042) (1-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-496) |
Form : | Lyophilized powder |
AA Sequence : | MESVTRHRADMISFFTFDSYISIVGVAYTAVGLLGVFCNVTTVIMILTNRVFRLSAYTIM ANVALADSIVMLIAGVACGMDVMWPNPNDLTSFIPSLEEPYQKIAPVSLRNDSKTDSSAA GFETGNIHAVLSFSFVAAWTAGVISYAMLGTNRCIAICYYGTKARALNQVSVAVACSAST WIVGIAAALVGTLSQPMIGIQRTMWSISFLEPRPHTTLFFTLLCAANLLGLGAQWVCSTL VLLKIRQVKKKISKNKLNQNSANRFRKQVILALNEIIVTGNFKARLTFQFFYPSILCTIS TFLFFIKPYAFEYLSGWQLVILHLLWLCNHTCNPFIYAYFNDRMRLTYKEILTCAAIRYQ IRKRRSSHPFRMHGRHNVSKRSNAAGMKSTRISARSGRTNRDGNFVRNSLQMQSRDFEQL CEFIMRVNPLYDSSEGWRESSDDEPFQPEFTKELESAHNQGGSSRFDSEREAKSIVLDLG RQTVEHWVKFAKKASI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | K01A12.3 |
Synonyms | K01A12.3; Probable G-protein coupled receptor K01A12.3 |
UniProt ID | Q10042 |
◆ Recombinant Proteins | ||
RFL26144SF | Recombinant Full Length Shigella Flexneri Serotype 5B Upf0266 Membrane Protein Yobd(Yobd) Protein, His-Tagged | +Inquiry |
F8A2-1753HFL | Recombinant Full Length Human F8A2 Protein, C-Flag-tagged | +Inquiry |
DTNA-1391H | Recombinant Human DTNA Protein, His-tagged | +Inquiry |
CD68-0841H | Recombinant Human CD68 Protein | +Inquiry |
PRDM9-024H | Recombinant Human PRDM9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart Ventricle-221H | Human Heart Ventricle (RT) (Arrhythmia, infarct) Lysate | +Inquiry |
DYNC1I2-239HCL | Recombinant Human DYNC1I2 lysate | +Inquiry |
MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
CD5-2572HCL | Recombinant Human CD5 cell lysate | +Inquiry |
NCBP1-1171HCL | Recombinant Human NCBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All K01A12.3 Products
Required fields are marked with *
My Review for All K01A12.3 Products
Required fields are marked with *
0
Inquiry Basket