Recombinant Full Length Probable G-Protein Coupled Receptor Ah9.4(Ah9.4) Protein, His-Tagged
Cat.No. : | RFL17508CF |
Product Overview : | Recombinant Full Length Probable G-protein coupled receptor AH9.4(AH9.4) Protein (Q10907) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MAFLQSAYLVMVFTVPIAGVILNTYVLRKLIRVARKSVVRFETTSGLPLAAMSVGDSITL CALLMQAIFHITPKGEVPTVVLSSICKFGIFLIHSTSAFSVWCWFFLSVLRYIAVFHPFK YRTIWRQPRNALKFLAGAVGMFQIYTLIFVTYRQEEKSCGEYDVFHESAFKHVHLLDIFL FYAIPSLLRITLDFLVLIHCYSPFSVEGLDRVTIDRRYAISGPATTKRFSHTGETDTLDN KAHVALAISITASTNTPSVKRIHHGNPKKKTAMVMRSILISVLNLLLNLPSHIFRAWASY DESSLENEIVRTLEPIAQMMYFSQFACNAFYLATSIYETNGSPRNTVISSSNRHVSRCIS DDEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AH9.4 |
Synonyms | AH9.4; Probable G-protein coupled receptor AH9.4 |
UniProt ID | Q10907 |
◆ Native Proteins | ||
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
IgG-152R | Native Rat IgG Fab fragment | +Inquiry |
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-747R | Rabbit Thymus Lysate, Total Protein | +Inquiry |
RTP1-2118HCL | Recombinant Human RTP1 293 Cell Lysate | +Inquiry |
Esophagus-120M | Mouse Esophagus Lysate | +Inquiry |
ENTPD7-6590HCL | Recombinant Human ENTPD7 293 Cell Lysate | +Inquiry |
PPP1CA-2953HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AH9.4 Products
Required fields are marked with *
My Review for All AH9.4 Products
Required fields are marked with *
0
Inquiry Basket