Recombinant Full Length Probable Dipeptidase Pepe(Pepe) Protein, His-Tagged
Cat.No. : | RFL28713HF |
Product Overview : | Recombinant Full Length Probable dipeptidase pepE(pepE) Protein (P65810) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAA GAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPAL HMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEA DVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYH SDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYF VHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAV SVNNCPHELIVVPVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Probable dipeptidase pepE(pepE) |
UniProt ID | P65810 |
◆ Recombinant Proteins | ||
F2RL3-2752H | Recombinant Human F2RL3 protein, His-tagged | +Inquiry |
ARNT2-451R | Recombinant Rat ARNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL16-2865H | Recombinant Human IL16 protein(1211-1330 aa), C-His-tagged | +Inquiry |
SOCS5-15746M | Recombinant Mouse SOCS5 Protein | +Inquiry |
KRT28-4857H | Recombinant Human KRT28 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Hemocyanin-31S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free, SMCC Activated | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
MG-41H | Active Native Human MG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC12A4-1806HCL | Recombinant Human SLC12A4 293 Cell Lysate | +Inquiry |
VGLL1-412HCL | Recombinant Human VGLL1 293 Cell Lysate | +Inquiry |
CENPW-7990HCL | Recombinant Human C6orf173 293 Cell Lysate | +Inquiry |
AVPR2-8557HCL | Recombinant Human AVPR2 293 Cell Lysate | +Inquiry |
C10orf81-198HCL | Recombinant Human C10orf81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Probable dipeptidase pepE(pepE) Products
Required fields are marked with *
My Review for All Probable dipeptidase pepE(pepE) Products
Required fields are marked with *
0
Inquiry Basket