Recombinant Full Length Porthidium Hyoprora Nadh-Ubiquinone Oxidoreductase Chain 4(Mt-Nd4) Protein, His-Tagged
Cat.No. : | RFL29177BF |
Product Overview : | Recombinant Full Length Porthidium hyoprora NADH-ubiquinone oxidoreductase chain 4(MT-ND4) Protein (O03763) (1-231aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bothrocophias hyoprora (Amazonian hognose viper) (Porthidium hyoprora) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-231) |
Form : | Lyophilized powder |
AA Sequence : | PIAGSMVLAAILLKLGGYGIIRMMQVLPTTKTDMFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVATIIIQTPWGLSGALALMIAHGFTSSALFCLANTTYERTHTRILI LTRGLHNILPMATTWWLLANLMNIAIPPTMNFTGELLITSALFNWCPTTIIMLGLSMLIT ASYSLHMFLSTQMGQTTLNNQTEPTHSREHLLMTLHLIPLMMISMKPELII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND4 |
Synonyms | MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment |
UniProt ID | O03763 |
◆ Recombinant Proteins | ||
NR2F2-5991C | Recombinant Chicken NR2F2 | +Inquiry |
RFL16818MF | Recombinant Full Length Mouse Transmembrane And Coiled-Coil Domain-Containing Protein 5A(Tmco5A) Protein, His-Tagged | +Inquiry |
DNER-1245H | Recombinant Human DNER protein, hFc&His-tagged | +Inquiry |
Dync1li2-2697M | Recombinant Mouse Dync1li2 Protein, Myc/DDK-tagged | +Inquiry |
Cwf19l1-2384M | Recombinant Mouse Cwf19l1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
EPX-8107H | Native Human Eosinophil Peroxidase | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
VIM-186B | Native bovine VIM | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Skeletal Muscle-432G | Guinea Pig Skeletal Muscle Lysate | +Inquiry |
CCNH-7705HCL | Recombinant Human CCNH 293 Cell Lysate | +Inquiry |
CTTNBP2-7189HCL | Recombinant Human CTTNBP2 293 Cell Lysate | +Inquiry |
CRK-7276HCL | Recombinant Human CRK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MT-ND4 Products
Required fields are marked with *
My Review for All MT-ND4 Products
Required fields are marked with *
0
Inquiry Basket