Recombinant Full Length Pongo Abelii Transmembrane Protein 199(Tmem199) Protein, His-Tagged
Cat.No. : | RFL3724PF |
Product Overview : | Recombinant Full Length Pongo abelii Transmembrane protein 199(TMEM199) Protein (Q5RAS8) (1-208aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-208) |
Form : | Lyophilized powder |
AA Sequence : | MASSLLAGERLVRALGPGGELEPELLPRKLRAELEAALGKKHTGGDSSSGPQRLVSFRLI RDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITR NVTCQDTRHGGTLSDLGKQVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVL AALIVASVVGLAELYVMVRAMEGELGEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM199 |
Synonyms | TMEM199; Transmembrane protein 199 |
UniProt ID | Q5RAS8 |
◆ Recombinant Proteins | ||
SIN3A-15141M | Recombinant Mouse SIN3A Protein | +Inquiry |
FAT2-3126M | Recombinant Mouse FAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
POU3F4-2607H | Recombinant Human POU3F4 Protein, MYC/DDK-tagged | +Inquiry |
AYP1020-RS07560-4866S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS07560 protein, His-tagged | +Inquiry |
ATP5F1-37H | Recombinant Human ATP5F1, His-tagged | +Inquiry |
◆ Native Proteins | ||
XOD-22B | Native Bovine XOD Protein | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-9H | Human Adult Thymus Membrane Lysate | +Inquiry |
Colon-840P | Pig Colon Membrane Lysate, Total Protein | +Inquiry |
RUFY1-1549HCL | Recombinant Human RUFY1 cell lysate | +Inquiry |
GSTT1-312HCL | Recombinant Human GSTT1 lysate | +Inquiry |
ZNF263-2001HCL | Recombinant Human ZNF263 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM199 Products
Required fields are marked with *
My Review for All TMEM199 Products
Required fields are marked with *
0
Inquiry Basket