Recombinant Full Length Pongo Abelii Regulator Of Microtubule Dynamics Protein 3(Fam82A2) Protein, His-Tagged
Cat.No. : | RFL114PF |
Product Overview : | Recombinant Full Length Pongo abelii Regulator of microtubule dynamics protein 3(FAM82A2) Protein (Q5R6Z1) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLGYTQTSDPG RQVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAG EIVGEVRSHMEENQRVARRRRFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTAN AESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLP LLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY ALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKEHVDKAIALQP ENPMAYFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAG RVYISKCYRELGKNSEARWWMKLALELPDVTKEDLALQKDLEELEVILRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RMDN3 |
Synonyms | RMDN3; FAM82A2; FAM82C; Regulator of microtubule dynamics protein 3; RMD-3; Protein FAM82A2; Protein FAM82C |
UniProt ID | Q5R6Z1 |
◆ Recombinant Proteins | ||
ELSPBP1-1457R | Recombinant Rhesus monkey ELSPBP1 Protein, His-tagged | +Inquiry |
SLC24A2-5125R | Recombinant Rat SLC24A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11330XF | Recombinant Full Length Xanthomonas Oryzae Pv. Oryzae Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged | +Inquiry |
SAP045A-012-4525S | Recombinant Staphylococcus epidermidis (strain: CDC9, other: OxS) SAP045A_012 protein, His-tagged | +Inquiry |
HECTD3-4618Z | Recombinant Zebrafish HECTD3 | +Inquiry |
◆ Native Proteins | ||
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
PSA-01H | Native Human PSA-ACT Complex Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMILIN1-553HCL | Recombinant Human EMILIN1 cell lysate | +Inquiry |
PSMD2-2750HCL | Recombinant Human PSMD2 293 Cell Lysate | +Inquiry |
MT1F-4102HCL | Recombinant Human MT1F 293 Cell Lysate | +Inquiry |
SAFB2-1556HCL | Recombinant Human SAFB2 cell lysate | +Inquiry |
RPRD2-904HCL | Recombinant Human RPRD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RMDN3 Products
Required fields are marked with *
My Review for All RMDN3 Products
Required fields are marked with *
0
Inquiry Basket