Recombinant Full Length Pongo Abelii Potassium Voltage-Gated Channel Subfamily S Member 1(Kcns1) Protein, His-Tagged
Cat.No. : | RFL11711PF |
Product Overview : | Recombinant Full Length Pongo abelii Potassium voltage-gated channel subfamily S member 1(KCNS1) Protein (A4K2V2) (1-526aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-526) |
Form : | Lyophilized powder |
AA Sequence : | MLMLLVRGTHYENLRPKVVLPTPLVGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLGLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHR EFEDLLSSVDGVSEASLETSRETSQEGRSADLESQAPSEPPHPQMY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNS1 |
Synonyms | KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1 |
UniProt ID | A4K2V2 |
◆ Recombinant Proteins | ||
APOB-2095P | Recombinant Pig APOB protein, His & GST-tagged | +Inquiry |
SNAP47-15666M | Recombinant Mouse SNAP47 Protein | +Inquiry |
ANP32B-618H | Recombinant Human ANP32B protein, GST-tagged | +Inquiry |
RFL7824PF | Recombinant Full Length Prochlorococcus Marinus Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged | +Inquiry |
NRTN-10902M | Recombinant Mouse NRTN Protein | +Inquiry |
◆ Native Proteins | ||
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
Glycated Albumin-006B | Native Bovine Glycated Albumin Protein | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DQB2-796HCL | Recombinant Human HLA-DQB2 cell lysate | +Inquiry |
VMA21-403HCL | Recombinant Human VMA21 293 Cell Lysate | +Inquiry |
NIH/3T3-065MCL | Mouse PDGF Stimulated NIH/3T3 Whole Cell Lysate | +Inquiry |
COX8C-7322HCL | Recombinant Human COX8C 293 Cell Lysate | +Inquiry |
CDK15-7633HCL | Recombinant Human CDK15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNS1 Products
Required fields are marked with *
My Review for All KCNS1 Products
Required fields are marked with *
0
Inquiry Basket