Recombinant Full Length Polypeptide N-Acetylgalactosaminyltransferase 3(Gly-3) Protein, His-Tagged
Cat.No. : | RFL5154CF |
Product Overview : | Recombinant Full Length Polypeptide N-acetylgalactosaminyltransferase 3(gly-3) Protein (P34678) (1-612aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-612) |
Form : | Lyophilized powder |
AA Sequence : | MLSVGGGRSAVCRAVIATSIVWLLIDVVILFYYLDPSTSQQQPFPEDNRILNRARRIEPLPPAAQHDSDPDAHPIQPEKQEKQVYPVDKETANQLRKLMETQAFGPGYHGQGGTGVTVPEDKKTIKEKRFLENQFNVVASEMISVNRTLPDYRSDACRTSGNNLKTAGMPKTSIIIVFHNEAWTTLLRTLHSVINRSPRHLLEEIILVDDKSDRDYLVKPLDSYIKMFPIPIHLVHLENRSGLIRARLTGSEMAKGKILLFLDAHVEVTDGWLEPLVSRVAEDRKRVVAPIIDVISDDTFEYVTASETTWGGFNWHLNFRWYAVPKRELNRRGSDRSMPIQTPTIAGGLFAIDKQFFYDIGSYDEGMQVWGGENLEISFRVWMCGGSLEIHPCSRVGHVFRKQTPYTFPGGTAKVIHHNAARTAEVWMDEYKAFFYKMVPAARNVEAGDVSERKKLRETLQCKSFKWYLENIYPEAPLPADFRSLGAIVNRFTEKCVDTNGKKDGQAPGIQACHGAGGNQAWSLTGKGEIRSDDLCLSSGHVYQIGSELKLERCSVSKINVKHVFVFDDQAGTLLHKKTGKCVTGADQRVTLDECGLGRKDQMWQLEGYQSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gly-3 |
Synonyms | gly-3; ZK688.8; Polypeptide N-acetylgalactosaminyltransferase 3; GalNAc-T1; Protein-UDP acetylgalactosaminyltransferase 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; pp-GaNTase 3 |
UniProt ID | P34678 |
◆ Recombinant Proteins | ||
LRP6-122H | Recombinant Human LRP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNASEL-6893HFL | Recombinant Full Length Human RNASEL protein, Flag-tagged | +Inquiry |
ALDH18A1-9550H | Recombinant Human ALDH18A1 protein, His-tagged | +Inquiry |
FAS-16H | Recombinant Human FAS protein, MYC/DDK-tagged | +Inquiry |
RFL5525CF | Recombinant Full Length Cyanothece Sp. Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERP2-1941HCL | Recombinant Human SERP2 293 Cell Lysate | +Inquiry |
PPYR1-1409HCL | Recombinant Human PPYR1 cell lysate | +Inquiry |
KIF3B-931HCL | Recombinant Human KIF3B cell lysate | +Inquiry |
RPL13-2226HCL | Recombinant Human RPL13 293 Cell Lysate | +Inquiry |
C5orf24-8017HCL | Recombinant Human C5orf24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gly-3 Products
Required fields are marked with *
My Review for All gly-3 Products
Required fields are marked with *
0
Inquiry Basket