Recombinant Full Length Anas Platyrhynchos Cytochrome C Oxidase Subunit 1(Mt-Co1) Protein, His-Tagged
Cat.No. : | RFL10358AF |
Product Overview : | Recombinant Full Length Anas platyrhynchos Cytochrome c oxidase subunit 1(MT-CO1) Protein (P50656) (1-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anas platyrhynchos (Mallard) (Anas boschas) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-102) |
Form : | Lyophilized powder |
AA Sequence : | MTFINRWLFSTNHKDIGTLYLIFGAWAGMIGTALSLLIRAELGQPGTLLGDDQIYNVIVT RHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-CO1 |
Synonyms | MT-CO1; COI; COXI; MTCO1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment |
UniProt ID | P50656 |
◆ Recombinant Proteins | ||
GNL3-448Z | Recombinant Zebrafish GNL3 | +Inquiry |
mpt64-1286M | Recombinant M. tuberculosis Immunogenic protein MPT64 Protein, His-tagged | +Inquiry |
ACTC1-135R | Recombinant Rat ACTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLB1-3553H | Recombinant Human PLB1 protein, His-tagged | +Inquiry |
EPDL1-8462Z | Recombinant Zebrafish EPDL1 | +Inquiry |
◆ Native Proteins | ||
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
IgG-352G | Native HAMSTER IgG | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF433-2025HCL | Recombinant Human ZNF433 cell lysate | +Inquiry |
A549-043WCY | Human Lung Adenocarcinoma A549 Whole Cell Lysate | +Inquiry |
LRRIQ3-1031HCL | Recombinant Human LRRIQ3 cell lysate | +Inquiry |
IL13RA1-1443RCL | Recombinant Rat IL13RA1 cell lysate | +Inquiry |
TSPAN4-708HCL | Recombinant Human TSPAN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MT-CO1 Products
Required fields are marked with *
My Review for All MT-CO1 Products
Required fields are marked with *
0
Inquiry Basket