Recombinant Full Length Pisum Sativum Cytochrome B6(Petb) Protein, His-Tagged
Cat.No. : | RFL11372HF |
Product Overview : | Recombinant Full Length Pisum sativum Cytochrome b6(petB) Protein () (1-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-215) |
Form : | Lyophilized powder |
AA Sequence : | MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTATFGVTGYSLPWDQIGYWAVKFVTGVPDAIPVIGSSXVELLPASASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGIFGPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pisum sativum Cytochrome b6(petB) |
◆ Native Proteins | ||
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
Fxa-283B | Active Native Bovine Factor Xa - DEGR | +Inquiry |
Lectin-1805L | Active Native Lycopersicon Esculentum Lectin Protein, Fluorescein labeled | +Inquiry |
Amyloid P native protein-3441H | Native Human Amyloid P native protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
PCDHGA10-1301HCL | Recombinant Human PCDHGA10 cell lysate | +Inquiry |
RBMS1-2463HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
P2RY12-3491HCL | Recombinant Human P2RY12 293 Cell Lysate | +Inquiry |
TGIF1-1115HCL | Recombinant Human TGIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pisum sativum Cytochrome b6(petB) Products
Required fields are marked with *
My Review for All Pisum sativum Cytochrome b6(petB) Products
Required fields are marked with *
0
Inquiry Basket