Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Ypbf(Ypbf) Protein, His-Tagged
Cat.No. : | RFL30459BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein ypbF(ypbF) Protein (P50732) (1-147aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-147) |
Form : | Lyophilized powder |
AA Sequence : | MESLWNQLDQFTDAPTKQMLQALVKRKQKFENYAAQCRRWRWASLICLGLLCVMIMIKSP EPQLILQEILSHTFYLFWMLATAFAYCTSYYFKKKEEKSETDFHKLRCEIIQKSTDLWPQ PDKWKARESVFHMMKHKYDINLYFESK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ypbF |
Synonyms | ypbF; BSU22990; Uncharacterized protein YpbF |
UniProt ID | P50732 |
◆ Native Proteins | ||
IgG-334D | Native Donkey IgG | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPIND1-2854HCL | Recombinant Human SERPIND1 cell lysate | +Inquiry |
REC8-2431HCL | Recombinant Human REC8 293 Cell Lysate | +Inquiry |
PLIN2-3107HCL | Recombinant Human PLIN2 293 Cell Lysate | +Inquiry |
COPS8-7352HCL | Recombinant Human COPS8 293 Cell Lysate | +Inquiry |
PCOLCE2-3374HCL | Recombinant Human PCOLCE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ypbF Products
Required fields are marked with *
My Review for All ypbF Products
Required fields are marked with *
0
Inquiry Basket