Recombinant Full Length Pig Tgf-Beta Receptor Type-2(Tgfbr2) Protein, His-Tagged
Cat.No. : | RFL7721SF |
Product Overview : | Recombinant Full Length Pig TGF-beta receptor type-2(TGFBR2) Protein (P38551) (24-297aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-297) |
Form : | Lyophilized powder |
AA Sequence : | IPPHVPKSVNSDMMVTDSNGAVKLPQLCKFCDVRSSTCDNQKSCLSNCSITAICEKPQEV CVAVWRKNDENITIETVCDDPKIAYHGFVLDDAASSKCIMKERKGSGETFFMCSCSSDEC NDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIITFYCYRVHRQQKLSPSWDS GKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKL RQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TGFBR2 |
Synonyms | TGFBR2; TGF-beta receptor type-2; TGFR-2; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; TGF-beta receptor type II; TbetaR-II; Fragment |
UniProt ID | P38551 |
◆ Recombinant Proteins | ||
Tgfbr2-6393M | Recombinant Mouse Tgfbr2 Protein, Myc/DDK-tagged | +Inquiry |
TGFBR2-4439H | Recombinant Human TGFBR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TGFBR2-1291H | Recombinant Human TGFBR2 Protein (L50-D159), Tag Free | +Inquiry |
Tgfbr2-2261R | Recombinant Rat Tgfbr2 protein, His&Myc-tagged | +Inquiry |
TGFBR2-377H | Active Recombinant Human TGFBR2 protein(Met1-Gln166), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFBR2 Products
Required fields are marked with *
My Review for All TGFBR2 Products
Required fields are marked with *
0
Inquiry Basket