Recombinant Full Length Pig Selenoprotein S(Sels) Protein, His-Tagged
Cat.No. : | RFL35417SF |
Product Overview : | Recombinant Full Length Pig Selenoprotein S(SELS) Protein (F1SR90) (1-190aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-190) |
Form : | Lyophilized powder |
AA Sequence : | MEQDGDQLSARPALETEGLRFLHVTVGSLLATYGWYIVFCCILLYVVFQKLSTRLRALRQ RHLDGAAAALEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRQKIERWD SVQEGRSYRGDARKRQEEDSPGPSTSSVIPKRKSDKKPLRGGGYNPLSGEGGGACSWRPG RRGPSSGGUG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SELENOS |
Synonyms | SELENOS; SELS; Selenoprotein S; SelS |
UniProt ID | F1SR90 |
◆ Native Proteins | ||
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
Immunoglobulin-5264B | Native Bovine Immunoglobulin Protein | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-491C | Chicken Kidney Lysate, Total Protein | +Inquiry |
AIFM2-8953HCL | Recombinant Human AIFM2 293 Cell Lysate | +Inquiry |
PRKCH-2855HCL | Recombinant Human PRKCH 293 Cell Lysate | +Inquiry |
LOX-4677HCL | Recombinant Human LOX 293 Cell Lysate | +Inquiry |
TSSK3-1848HCL | Recombinant Human TSSK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SELENOS Products
Required fields are marked with *
My Review for All SELENOS Products
Required fields are marked with *
0
Inquiry Basket