Recombinant Full Length Pig Interleukin-2 Receptor Subunit Alpha(Il2Ra) Protein, His-Tagged
Cat.No. : | RFL934SF |
Product Overview : | Recombinant Full Length Pig Interleukin-2 receptor subunit alpha(IL2RA) Protein (O02733) (22-270aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-270) |
Form : | Lyophilized powder |
AA Sequence : | GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQLAVAGCVLLLLSILLLSGLTWQRRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IL2RA |
Synonyms | IL2RA; Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; CD antigen CD25 |
UniProt ID | O02733 |
◆ Recombinant Proteins | ||
IL2RA-1246M | Acitve Recombinant Mouse IL2RA protein(Met1-Lys236), His-tagged | +Inquiry |
IL2RA-01H | Recombinant Human IL2RA protein, hIgG-His-tagged | +Inquiry |
IL2RA-186H | Recombinant Human IL2RA Protein (ECD), His-tagged(C-ter) | +Inquiry |
IL2RA-133CAF647 | Recombinant Monkey IL2RA Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
IL2RA-135CAF555 | Recombinant Cynomolgus IL2RA Protein, LEVLFQ-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RA-2024MCL | Recombinant Mouse IL2RA cell lysate | +Inquiry |
IL2RA-2907HCL | Recombinant Human IL2RA cell lysate | +Inquiry |
IL2RA-1015CCL | Recombinant Cynomolgus IL2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2RA Products
Required fields are marked with *
My Review for All IL2RA Products
Required fields are marked with *
0
Inquiry Basket