Recombinant Full Length Pichia Canadensis Nadh-Ubiquinone Oxidoreductase Chain 3(Nd3) Protein, His-Tagged
Cat.No. : | RFL35973WF |
Product Overview : | Recombinant Full Length Pichia canadensis NADH-ubiquinone oxidoreductase chain 3(ND3) Protein (P48913) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Wickerhamomyces canadensis (Yeast) (Pichia canadensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MLNYFVYPYGIENDIGIKFYMILVPIISIVLIIINYIITNKSDNNINKTGPYECGFDSFR QSRTTYSIKFILIAILFLPFDLELTSILPYTLSIYNLNIYGLFILLYFLLPLIIGFIIEI NLKAIYITKIFNRNVKSITSYVKYNNKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ND3 |
Synonyms | ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3 |
UniProt ID | P48913 |
◆ Native Proteins | ||
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3BGR-1875HCL | Recombinant Human SH3BGR 293 Cell Lysate | +Inquiry |
CYP2C8-7114HCL | Recombinant Human CYP2C8 293 Cell Lysate | +Inquiry |
PADI4-630HCL | Recombinant Human PADI4 cell lysate | +Inquiry |
PLUNC-3093HCL | Recombinant Human PLUNC 293 Cell Lysate | +Inquiry |
ZNF512-751HCL | Recombinant Human ZNF512 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ND3 Products
Required fields are marked with *
My Review for All ND3 Products
Required fields are marked with *
0
Inquiry Basket