Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL6110EF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P14813) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Euglena gracilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRFISVHLMHTALVSGWAGSMALYELAIFDPSDVALNPMWPQGM FVLPFMTRLGVTKSWGAWSVTGESFSDPGIWSYEGVAVAHIILSGLLFLAAIWHWVYWDL DLFRDPASGELKLDLPRVFGVHLFLSGALCLAFGVFHVTGVFGPGIWVSDPYGLSGKIEP VIPSWGAEGFDPYNVGAIASHHIAAGLLGLIAGGFHVLVRPSQRLFVLLRMGNIETVLSS SIAAVFWSAFVVSGTMWYGSASTPIELFGPTRYQWDKGYFQEEIERRVQASLSDGCSLSE AWGAISPKLAFYDYIGNNPAKGGLFRSGPMNNGDGIATAWLGHAVFIDKEGNSLFVRRMP TFFETFPVILLDQNGVVRADIPFRRAESKYSIEQVGVTVRFFGGSFDTLSFNDPATVKRY ARHAQLGEIFDFNRSILQSDGVFRSSPRGWFTFGHLSFALIFFFGHIWHGARTLFKYLLA GIDPHLEEEIEFGTFEKLGDDTTKKELV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P14813 |
◆ Recombinant Proteins | ||
DTL-1166R | Recombinant Rhesus Macaque DTL Protein, His (Fc)-Avi-tagged | +Inquiry |
SFT2D1-10690Z | Recombinant Zebrafish SFT2D1 | +Inquiry |
RFC2-5004R | Recombinant Rat RFC2 Protein | +Inquiry |
TIG-3784S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 TIG protein, His-tagged | +Inquiry |
RFL18041PF | Recombinant Full Length Pseudomonas Syringae Pv. Tomato Upf0114 Protein Pspto_4583(Pspto_4583) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-81H | Active Native Human FSH | +Inquiry |
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
Troponin C-085B | Native Bovine Troponin C Protein, Sepharose CL 4B attached | +Inquiry |
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT7B-288HCL | Recombinant Human WNT7B 293 Cell Lysate | +Inquiry |
LMBRD1-4716HCL | Recombinant Human LMBRD1 293 Cell Lysate | +Inquiry |
STK3-1405HCL | Recombinant Human STK3 293 Cell Lysate | +Inquiry |
LRRC10-4650HCL | Recombinant Human LRRC10 293 Cell Lysate | +Inquiry |
Heart-213R | Rhesus monkey Heart Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket