Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL1691OF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q0P3Q1) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ostreococcus tauri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNSTLVVGGRDQESTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLAALGYGVGPGGEVLDTFPYFVSGVLHLISSAVLGFGGVYHSL IGPETLEESYPFFGYLWKDKNKMTTILGIHLVLLGIGAWLLVWKAMYFGGVYDTWAPGGG DVRVISYPTYDPSVIFGYLLKSPFGGDGWIISVDNMEDVIGGHIWIGTTLIIGGFFHIFT KPFAWARRAFVWSGEAYLSYSLASVSLMAFIAAVFVWFNNTVYPSEFFGPTGPEASQAQA FTFLVRDQRLGANIASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDMRAPWVEPLRGPNG LDLSKLKNDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINSTNFVNPRSWLATSHYVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDTEPVLSMRPLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; OtCpg00010; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q0P3Q1 |
◆ Recombinant Proteins | ||
TLE3-091H | Recombinant Human TLE3 Protein, DDK-tagged | +Inquiry |
HA-750V | Active Recombinant H1N1 (A/California/06/2009) HA Protein, His-tagged | +Inquiry |
SMYD2-049H | Active Recombinant Human SMYD2 Protein, His/SUMO-tagged | +Inquiry |
RFL18847HF | Recombinant Full Length Human D(4) Dopamine Receptor(Drd4) Protein, His-Tagged | +Inquiry |
PNPO-27512TH | Recombinant Human PNPO, His-tagged | +Inquiry |
◆ Native Proteins | ||
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC27A5-1626HCL | Recombinant Human SLC27A5 cell lysate | +Inquiry |
FUS-6118HCL | Recombinant Human FUS 293 Cell Lysate | +Inquiry |
DSG1-512HCL | Recombinant Human DSG1 cell lysate | +Inquiry |
TGFBR3-1847MCL | Recombinant Mouse TGFBR3 cell lysate | +Inquiry |
OTUB1-3516HCL | Recombinant Human OTUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket