Recombinant Full Length Lactuca Sativa Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL34486LF |
Product Overview : | Recombinant Full Length Lactuca sativa Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q332Y2) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactuca sativa (Garden lettuce) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSIIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRALVWSGEAYLSYSLAAISVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q332Y2 |
◆ Recombinant Proteins | ||
GPR27-5509HF | Recombinant Full Length Human GPR27 Protein | +Inquiry |
YJNA-3199B | Recombinant Bacillus subtilis YJNA protein, His-tagged | +Inquiry |
RNF8-14355M | Recombinant Mouse RNF8 Protein | +Inquiry |
TAGLN3-5921R | Recombinant Rat TAGLN3 Protein | +Inquiry |
PKNOX2-12877M | Recombinant Mouse PKNOX2 Protein | +Inquiry |
◆ Native Proteins | ||
LDH2-8340H | Native Human LDH2 | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT5B-1709HCL | Recombinant Human STAT5B cell lysate | +Inquiry |
MAFA-4562HCL | Recombinant Human MAFA 293 Cell Lysate | +Inquiry |
PPP1CB-2949HCL | Recombinant Human PPP1CB 293 Cell Lysate | +Inquiry |
SMCO4-8334HCL | Recombinant Human C11orf75 293 Cell Lysate | +Inquiry |
MAST4-1009HCL | Recombinant Human MAST4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket