Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL21440CF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (P48104) (3-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanophora paradoxa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (3-461) |
Form : | Lyophilized powder |
AA Sequence : | TLFNSSVAVSGRDQQSTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWTGAMTLFEVAH FIPEKPMYEQGLILLPHLATLGWGVGPGGEVIDVYPYFVVGVLHLVSSAVLGFGGLYHAI IGPEVLEESFPFFGYDWKDKNKMTTIIGIHLILLGSGALLLVLKAMFFGGVYDTWAPGGG DVRVISNPTLNPTVIFSYITKSPWGGDGWIVSVDNMEDIIGGHIWLAFICIIGGVWHILT KPFSWARRALVWSGEAYLSYSLAALALMGFIANCFVWFNNTAYPSEFFGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPSGEIIFGGETMRFWDTRAPWLEPLRGANG LDLTKIKYDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLSTSHFVLG FFLFIGHLWHAGRARAASGGFEKGLDRENEPVLSMKLLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | P48104 |
◆ Native Proteins | ||
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
Chitosan-003C | Native Crawfish Chitosan Water Soluble | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASA3-1474HCL | Recombinant Human RASA3 cell lysate | +Inquiry |
SLC12A7-597HCL | Recombinant Human SLC12A7 lysate | +Inquiry |
FGFR1OP-001HCL | Recombinant Human FGFR1OP cell lysate | +Inquiry |
Spinal Cord-001CCL | Adult Chicken Spinal Cord Whole Cell Lysate | +Inquiry |
NFKBIL2-3846HCL | Recombinant Human NFKBIL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket