Recombinant Full Length Lemna Minor Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL16103LF |
Product Overview : | Recombinant Full Length Lemna minor Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (A9L992) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lemna Minor |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGGMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGLGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLNPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRAFVWSGEAYLSYSLAALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDLEPVLFMTPLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | A9L992 |
◆ Recombinant Proteins | ||
Dph6-1780M | Recombinant Mouse Dph6 Protein, Myc/DDK-tagged | +Inquiry |
FANCC-3828H | Recombinant Human FANCC Protein, GST-tagged | +Inquiry |
US4-4863H | Recombinant HSV-1 US4 Protein, GST-tagged | +Inquiry |
MDH1B-5431M | Recombinant Mouse MDH1B Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAZ-467HFL | Recombinant Full Length Human YWHAZ Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Acta1-158M | Native Mouse skeletal muscle alpha Actin | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASN-1392HCL | Recombinant Human VASN cell lysate | +Inquiry |
IFNAR1-2372MCL | Recombinant Mouse IFNAR1 cell lysate | +Inquiry |
MAP3K14-4507HCL | Recombinant Human MAP3K14 293 Cell Lysate | +Inquiry |
XRCC5 & XRCC6-543HCL | Recombinant Human XRCC5 & XRCC6 cell lysate | +Inquiry |
CLEC2D-737RCL | Recombinant Rat CLEC2D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket