Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL11019PF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (P51356) (29-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porphyra purpurea (Red seaweed) (Ulva purpurea) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-487) |
Form : | Lyophilized powder |
AA Sequence : | TPFNTNVGVGGRDIESTGFAWWSGNARLINVSGKLLGAHVAHAGIMVFWTGAMTLFEVAH FVPEKPLYEQGLILIPHLATLGWGVGPGGEIFNTYPYFVVGVVHLISSAVLGFGGLYHSL IGPDTLEESFPFFGYDWRDKNKMTTILGIHLVLLGIGAFLLVIKSLFVGGVYDTWAPGGG DVRFVSNPTLNPLVIFGYVLKSPFGGDGWIVSVNNMEDLIGGHVWIGIICIAGGIWHILT KPFAWARRAFVWSGEAYLSYSLGALSIMGLTASNFVWYNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVASSQGPTGLGKYLMRSPSGEIIFGGETMRFWDLRAPWVEPLRGPNG LDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHFFLG FFLFIGHLWHAGRARAAAAGFEKGINRENEPVLSMRPLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | P51356 |
◆ Recombinant Proteins | ||
Pdgfb-639R | Recombinant Rat Pdgfb protein, His & GST-tagged | +Inquiry |
SAA1-3692H | Recombinant Human SAA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL2RA-1237H | Recombinant Human Interleukin 2 Receptor, Alpha | +Inquiry |
CD38-1249R | Recombinant Rat CD38 Protein | +Inquiry |
RFL5688GF | Recombinant Full Length Chicken Suppressor Of Tumorigenicity 7 Protein-Like(St7L) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IGF2-29116TH | Native Human IGF2 | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC134-1685HCL | Recombinant Human CCDC134 cell lysate | +Inquiry |
SLC9A1-1695HCL | Recombinant Human SLC9A1 293 Cell Lysate | +Inquiry |
HAL-5641HCL | Recombinant Human HAL 293 Cell Lysate | +Inquiry |
TMUB1-1800HCL | Recombinant Human TMUB1 cell lysate | +Inquiry |
FOXJ2-6154HCL | Recombinant Human FOXJ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket