Recombinant Full Length Photobacterium Profundum Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL31564PF |
Product Overview : | Recombinant Full Length Photobacterium profundum ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q6LUJ8) (1-696aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Photobacterium profundum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-696) |
Form : | Lyophilized powder |
AA Sequence : | MWLQVTNCSTLHSSLSYCGANTLSDMAKNLILWLVIAVVLMSVFQSFGPSDSAGRQVDYT TFVREIGQDQIREARFNEREITVFKRDNTRYVTYLPVFNDQKLLDDLINANVKVLGTPPE EPSLLASIFISWFPMLLLIGVWVFFMRQMQGGGGGKGAMSFGKSKARMMSEDQIKTTFAD VAGCDEAKEDVKELVDYLRDPSRFQKLGGKIPTGILLVGPPGTGKTLLAKAIAGEAKVPF FTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGVGGGHDEREQ TLNQMLVEMDGFEGNEGVIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKV HMRKVPLEGDVEPSLIARGTPGFSGADLANLVNEAALFAARGNKRVVSMQEFELAKDKIM MGAERKSMVMSEDQKESTAYHEAGHAIIGRLVPDHDPVYKVSIIPRGRALGVTMYLPEKD RISHSREFLESMLSSLYGGRLAEELIYGVDKVSTGASNDIERATDIARKMVTQWGFSEKM GPVLYADDEGEVFLGRSVTQTKHMSDDTARAIDMEIRALIDRNYERAREILAQNMDIMHA MKDALMKYETIDAAQIDDLMARKSEIRAPKGWGDTDDVMKSSPTTSESAPEAKTESAPEA KAEANVETEEKPVAADSEELKPKAEQAPKEDDKPQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; PBPRA0604; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q6LUJ8 |
◆ Recombinant Proteins | ||
YXXE-1120B | Recombinant Bacillus subtilis YXXE protein, His-tagged | +Inquiry |
NPFF-712H | Recombinant Human NPFF | +Inquiry |
B4GALNT2-1690H | Recombinant Human B4GALNT2 protein, His & T7-tagged | +Inquiry |
HEPACAM2-1094H | Recombinant Human HEPACAM2 Protein, MYC/DDK-tagged | +Inquiry |
NMNAT1-77H | Active Recombinant Human NMNAT1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
SERPING1-73H | Native Human C1 Esterase inhibitor | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF25-1998HCL | Recombinant Human ZNF25 cell lysate | +Inquiry |
ZNF200-126HCL | Recombinant Human ZNF200 293 Cell Lysate | +Inquiry |
B3GNT1-8544HCL | Recombinant Human B3GNT1 293 Cell Lysate | +Inquiry |
NOV-694HCL | Recombinant Human NOV cell lysate | +Inquiry |
FMR1NB-6178HCL | Recombinant Human FMR1NB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket