Recombinant Full Length Phosphatidylinositol Mannoside Acyltransferase (Rv2611C, Mt2686) Protein, His-Tagged
Cat.No. : | RFL29542HF |
Product Overview : | Recombinant Full Length Phosphatidylinositol mannoside acyltransferase (Rv2611c, MT2686) Protein (O06203) (1-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-316) |
Form : | Lyophilized powder |
AA Sequence : | MIAGLKGLKLPKDPRSSVTRTATDWAYAAGWMAVRALPEFAVRNAFDTGARYFARHGGPE QLRKNLARVLGVPPAAVPDPLMCASLESYGRYWREVFRLPTINHRKLARQLDRVIGGLDH LDAALAAGLGAVLALPHSGNWDMAGMWLVQRHGTFTTVAERLKPESLYQRFIDYRESLGF EVLPLSGGERPPFEVLSERLRNNRVVCLMAERDLTRTGVEVDFFGEPTRMPVGPAKLAVE TGAALLPTHCWFEGRGWGFQVYPALDCTSGDVAAITQALADRFAQNIAAHPADWHMLQPQ WLADLSESRRAQLRSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Phosphatidylinositol mannoside acyltransferase (Rv2611c, MT2686) |
UniProt ID | O06203 |
◆ Recombinant Proteins | ||
TMCO6-3269H | Recombinant Human TMCO6, GST-tagged | +Inquiry |
EED-2644M | Recombinant Mouse EED Protein, His (Fc)-Avi-tagged | +Inquiry |
Gatm-3164M | Recombinant Mouse Gatm Protein, Myc/DDK-tagged | +Inquiry |
Kdm1a-3680M | Recombinant Mouse Kdm1a Protein, Myc/DDK-tagged | +Inquiry |
USP34-17923M | Recombinant Mouse USP34 Protein | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin E-80H | Native Human Immunoglobulin E | +Inquiry |
ALB-316B | Native Bovine Albumin Protein, Biotinylated | +Inquiry |
Lectin-1840S | Active Native Sambucus Nigra Lectin Protein, Cy5 labeled | +Inquiry |
Lecithin-10S | Native Soy Lecithin | +Inquiry |
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAI1-6896HCL | Recombinant Human DNAI1 293 Cell Lysate | +Inquiry |
FBXO33-603HCL | Recombinant Human FBXO33 cell lysate | +Inquiry |
RUSC1-AS1-8190HCL | Recombinant Human C1orf104 293 Cell Lysate | +Inquiry |
TCF25-1181HCL | Recombinant Human TCF25 293 Cell Lysate | +Inquiry |
KRT18-4876HCL | Recombinant Human KRT18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Phosphatidylinositol mannoside acyltransferase (Rv2611c, MT2686) Products
Required fields are marked with *
My Review for All Phosphatidylinositol mannoside acyltransferase (Rv2611c, MT2686) Products
Required fields are marked with *
0
Inquiry Basket