Recombinant Full Length Phosphatidylinositol:Ceramide Inositolphosphotransferase(Ipcs) Protein, His-Tagged
Cat.No. : | RFL25906LF |
Product Overview : | Recombinant Full Length Phosphatidylinositol:ceramide inositolphosphotransferase(IPCS) Protein (E9AFX2) (1-338aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leishmania major |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-338) |
Form : | Lyophilized powder |
AA Sequence : | MTSHVTAHDVGGNEDIGTDHVPWYKQPLPLCTQVMRFILLLLLTVMFLGVAILVANARMP DPEKVRPLPDLLLESIPKVALLENGTNVIIFLLNATTVVVGFKVFLLERHMNGLPRVTFL VGVPKIGSFLNRMAFGVLDSGRRPFPLKNVFPIMAIRFLTSYAVVMVFRAFVIMGTSYPA TDNHCQNPQVIEHPVLNVILTLVTLGSGAIHCGDLMFSGHTMILSLAFILAWDYSPFLHP WAVRVWVSVLLPISYYCILASRSHYTDDILVAMYVMIATYKVIDHAETGAPWQMQLLIRW MPWPGANTIEKWTADEVVVVVQTPAEDSTDASAALPEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IPCS |
Synonyms | IPCS; LMJF_35_4990; Phosphatidylinositol:ceramide inositolphosphotransferase; LmjIPCS; Inositol-phosphorylceramide synthase; IPC synthase; Sphingolipid synthase |
UniProt ID | E9AFX2 |
◆ Recombinant Proteins | ||
NFATC2-29251TH | Recombinant Human NFATC2, His-tagged | +Inquiry |
ZFP191-18846M | Recombinant Mouse ZFP191 Protein | +Inquiry |
ARMC7-237R | Recombinant Rhesus Macaque ARMC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMELY-9613H | Recombinant Human AMELY, GST-tagged | +Inquiry |
FBLIM1-7602H | Recombinant Human FBLIM1, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
L. pneumophila-26 | Native Legionella pneumophila Antigen | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB12-646MCL | Recombinant Mouse SERPINB12 cell lysate | +Inquiry |
ARL11-8722HCL | Recombinant Human ARL11 293 Cell Lysate | +Inquiry |
AP4B1-8806HCL | Recombinant Human AP4B1 293 Cell Lysate | +Inquiry |
PTCD2-2725HCL | Recombinant Human PTCD2 293 Cell Lysate | +Inquiry |
PSME3-2739HCL | Recombinant Human PSME3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IPCS Products
Required fields are marked with *
My Review for All IPCS Products
Required fields are marked with *
0
Inquiry Basket