Recombinant Full Length Phalaenopsis Aphrodite Subsp. Formosana Apocytochrome F(Peta) Protein, His-Tagged
Cat.No. : | RFL2335PF |
Product Overview : | Recombinant Full Length Phalaenopsis aphrodite subsp. formosana Apocytochrome f(petA) Protein (Q3BAM8) (36-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phalaenopsis aphrodite subsp. formosana (Moth orchid) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-320) |
Form : | Lyophilized powder |
AA Sequence : | YPIFAQQVYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVIILPEGFELAPPDRISPEIKEKMGNLSFQFYRPNKRNILVIGPVPG QKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATSAGIVS RIARKEKGGYEITIVDASEGRQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD TEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLYEMNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petA |
Synonyms | petA; Cytochrome f |
UniProt ID | Q3BAM8 |
◆ Native Proteins | ||
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
AVD-3786C | Native Chicken AVD | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPSL-7854HCL | Recombinant Human CAPSL 293 Cell Lysate | +Inquiry |
DYRK1B-6751HCL | Recombinant Human DYRK1B 293 Cell Lysate | +Inquiry |
CXXC4-7150HCL | Recombinant Human CXXC4 293 Cell Lysate | +Inquiry |
Duodenum-524D | Dog Duodenum Lysate, Total Protein | +Inquiry |
C9orf152-7941HCL | Recombinant Human C9orf152 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All petA Products
Required fields are marked with *
My Review for All petA Products
Required fields are marked with *
0
Inquiry Basket