Recombinant Full Length Phaeosphaeria Nodorum Bifunctional Lycopene Cyclase/Phytoene Synthase(Snog_00339) Protein, His-Tagged
Cat.No. : | RFL31352PF |
Product Overview : | Recombinant Full Length Phaeosphaeria nodorum Bifunctional lycopene cyclase/phytoene synthase(SNOG_00339) Protein (Q0V6M5) (1-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phaeosphaeria nodorum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-585) |
Form : | Lyophilized powder |
AA Sequence : | MGFDYAIVHVKYTIPPAVLLTLLYRPLFTKLDAFKVLFLVTVAVTATIPWDSYLIRTNIW SYPDHVVIGPTLLDIPLEEVFFFFIQTYNTTLLYLILSKPTFQPAYLRAGRPTASSPWKY QKLAGQLFLVGATVWAGLRVHENAKGTYTGLIVVWAAPIILLQWTLAYQFILGLPWTNTV LPIAIPTLYLWLVDTLALRRGTWVISPGTKYGVHLWDGLEIEEALFFFVTNTLIVFGQLA FDNALAVLYTFPALFPKPPSMPTPLDLINALWVSPYKYDRARLAGLQDAVLRLKRKSRSF YLASATFPGPLRSDLLLLYSFCRVADDLVDNAATAEEAKEWISKLHQYLDLVYSDAKSST VSEDFVQAHFPSDARSALLQLPAHKLPRQPLQDLLHGFEMDLAFNTSSPIKTETDLRLYS ERVAGTVAQMCIELIFRLYPSNMTSGEERKVVDAGNQMGMALQYVNIARDISVDAHIGRV YLPLDWLQESGLTYDEVLISPEGARMESLRMRLLEKAFSIYDGARGAIETLPVEARGPIR VAVESYMEIGRTLRQKGYTVRAGRATVSKWRRVIVAWRTLNKSIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SNOG_00339 |
Synonyms | SNOG_00339; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | Q0V6M5 |
◆ Native Proteins | ||
LH-12P | Native Porcine Luteinizing Hormone Protein | +Inquiry |
ALB-5362B | Native Bovine Albumin | +Inquiry |
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
Lectin-1803L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 594 labeled | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
C7orf34-128HCL | Recombinant Human C7orf34 lysate | +Inquiry |
BCCIP-002HCL | Recombinant Human BCCIP cell lysate | +Inquiry |
WWOX-274HCL | Recombinant Human WWOX 293 Cell Lysate | +Inquiry |
SOHLH2-1667HCL | Recombinant Human SOHLH2 cell lysate | +Inquiry |
LAT-4817HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNOG_00339 Products
Required fields are marked with *
My Review for All SNOG_00339 Products
Required fields are marked with *
0
Inquiry Basket